y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g20790.1
FamilyGH77
Protein PropertiesLength: 587 Molecular Weight: 64919.1 Isoelectric Point: 5.6525
ChromosomeChromosome/Scaffold: 1 Start: 16685685 End: 16690239
Descriptiondisproportionating enzyme
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77945790
  LHPTSLRGPHGIGDLGDEALAFLHWLRDAGCTLWQVLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLMEDELPAPLDVEYVEFDTVANLK
  EPLIAKAAERLLLSHGELRMQYDEFKRNPDISGWLEDAALFAAIDKSIDALSWYEWPEPLKNRHLGALEDIYQKQKDFIEIFMAQQFLFQKQWQRVRTHA
  QKLGISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWKFMEADGFTWWVKRIKRALDLYDEFRIDHFRGLAGFWA
  VLSDAEVAMVGSWRAGPRNAFFDALFKAVGRANIIAEDLGVITGDVVELRKSIGAPGMAVLQFAFSGGSGNPHLPHNHELNQVVYTGTHDNDTVVGWWKS
  LPEEEKQTVLKYLPEASKTDVSWALITTALSSVARTSMVTMQDILGLDSSARMNTPATQKGNWRWRIPSSVSFDSLNPEAAKLKEL
Full Sequence
Protein Sequence     Length: 587     Download
MALARTLPLP HLAPAPASPG RLRGCIRVLP ALSSQAGAPP AARGIACRSS KATTMTTTAA    60
EVAAVGVGEE LPEGYEQMMP TVEESRRRRA GVLLHPTSLR GPHGIGDLGD EALAFLHWLR    120
DAGCTLWQVL PLVPPGRKSG EDGSPYSGQD ANCGNTLLIS LEELVKDGLL MEDELPAPLD    180
VEYVEFDTVA NLKEPLIAKA AERLLLSHGE LRMQYDEFKR NPDISGWLED AALFAAIDKS    240
IDALSWYEWP EPLKNRHLGA LEDIYQKQKD FIEIFMAQQF LFQKQWQRVR THAQKLGISI    300
MGDMPIYVGY HSADVWANRK SFLLDKNGFP TFVSGVPPDA FSETGQLWNS PLYDWKFMEA    360
DGFTWWVKRI KRALDLYDEF RIDHFRGLAG FWAVLSDAEV AMVGSWRAGP RNAFFDALFK    420
AVGRANIIAE DLGVITGDVV ELRKSIGAPG MAVLQFAFSG GSGNPHLPHN HELNQVVYTG    480
THDNDTVVGW WKSLPEEEKQ TVLKYLPEAS KTDVSWALIT TALSSVARTS MVTMQDILGL    540
DSSARMNTPA TQKGNWRWRI PSSVSFDSLN PEAAKLKELL AFYSRL*                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ1.0e-10880580511+
COG1640MalQ2.0e-13485585517+
pfam02446Glyco_hydro_775.0e-17894583506+
PLN02635PLN02635071586516+
PRK14508PRK14508086586504+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ23613.1015861578disproportionating enzyme [Aegilops tauschii]
GenBankACN26217.1015851587unknown [Zea mays]
GenBankEEC82491.106658635555hypothetical protein OsI_26949 [Oryza sativa Indica Group]
GenBankEEE67630.106658635555hypothetical protein OsJ_25204 [Oryza sativa Japonica Group]
RefSeqXP_002461064.1015851589hypothetical protein SORBIDRAFT_02g040000 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A0635861524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2owx_A0885868503A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2oww_A0885868503A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2owc_A0885868503A Chain A, Structure Of A Covalent Intermediate In Thermus Thermophilus Amylomaltase
PDB1fp9_A0885865500A Chain A, Structure Of A Covalent Intermediate In Thermus Thermophilus Amylomaltase
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1828EC-2.4.1.254-α-glucanotransferase
starch degradation IIRXN-12391EC-2.4.1.254-α-glucanotransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO4350354791085850
GO8480792952715640
GO8445722842715530
GO8481732762715450
GO844572375515870.0006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)