y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g22147.1
FamilyPL1
Protein PropertiesLength: 335 Molecular Weight: 37478.5 Isoelectric Point: 6.7297
ChromosomeChromosome/Scaffold: 1 Start: 17801658 End: 17803202
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1682470
  IVFEVSGTIDLQSYLRVSSYKTIDGRGHRVKLTGKGLQLRDCHHVIVCNLEFEGGRGHDVDGIQIKPNSSNIWIDRCTLADYDDGLIDITRQSTDITVSR
  CHFSRHDKTMLIGADPTHVGDRCIRVTIHHCFFDCTRQRHPRLRFGKVHLYNNYTRNWGIYAVCASVEAQIVSQSNIYQA
Full Sequence
Protein Sequence     Length: 335     Download
MEIPRPPETQ MPYGDADCTL RALAARAEGF GCHAIGGLHG ALYYVTSLQD DGCGTLREAC    60
RIKEPLWIVF EVSGTIDLQS YLRVSSYKTI DGRGHRVKLT GKGLQLRDCH HVIVCNLEFE    120
GGRGHDVDGI QIKPNSSNIW IDRCTLADYD DGLIDITRQS TDITVSRCHF SRHDKTMLIG    180
ADPTHVGDRC IRVTIHHCFF DCTRQRHPRL RFGKVHLYNN YTRNWGIYAV CASVEAQIVS    240
QSNIYQAGEK KTVFKYMPEK AGDKEEVAAG WIRSEGDAFL QGAQSCLIDG PGVDTVFRPE    300
HYYDKWTMET ASPALKEVIE LCAGWQPVPR PPDC*                               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C1.0e-4063243201+
COG3866PelB4.0e-4636254238+
smart00656Amb_all2.0e-6782248179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN25563.101033339364unknown [Zea mays]
GenBankEAY74463.101133241362hypothetical protein OsI_02351 [Oryza sativa Indica Group]
RefSeqNP_001043284.101133241362Os01g0546800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149991.101033237361LOC100283618 [Zea mays]
RefSeqXP_002442919.101133340364hypothetical protein SORBIDRAFT_08g004905 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B1.99965e-422328321307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A1.99965e-422328321307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A4e-283524722248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A9e-2482245128330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pcl_A1e-223632516352A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG177860304283310
DY275282323113330
DW066041298343310
DY277275310113200
CX546286292163070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)