y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g23050.1
FamilyGT77
Protein PropertiesLength: 425 Molecular Weight: 47917.8 Isoelectric Point: 8.7688
ChromosomeChromosome/Scaffold: 1 Start: 18496580 End: 18500142
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771794010
  ISNYLVVALDDSVESFCKSKDVPVYRRDPDEGIDSIGKTGGNHAVSALKFQILREFLQLGYSVLLSDIDIMFFQNPFDHLHRDSDIESMSDGHNNMTAYG
  FNDVFDEPSMGWARYAHTMRIWVYNSGFFFIRPTIPSIELLDRVAGRLSREPKSWDQAVFNEELFFPSHPGYEGLHASKRTMDIYLFMNSKVLFKTVRKD
  AYLRNLKPVIVHLNYHPDKEERM
Full Sequence
Protein Sequence     Length: 425     Download
MAGRREAPLM RSGSGSGQPL SRGSRIAAAV AVGVTLGCVC AFLYPDGLIS RSSDSALHWP    60
RRADSVACET SEKVDYLKSQ LASLERKNAE FRKQINELSM KLQMAEHGKT KALYRAGPFG    120
TVKAFRTNPT VMPDETINPR LAKILQQVAV KKELIVAVAN SNVKQTLEMW FTNIKRVGIS    180
NYLVVALDDS VESFCKSKDV PVYRRDPDEG IDSIGKTGGN HAVSALKFQI LREFLQLGYS    240
VLLSDIDIMF FQNPFDHLHR DSDIESMSDG HNNMTAYGFN DVFDEPSMGW ARYAHTMRIW    300
VYNSGFFFIR PTIPSIELLD RVAGRLSREP KSWDQAVFNE ELFFPSHPGY EGLHASKRTM    360
DIYLFMNSKV LFKTVRKDAY LRNLKPVIVH LNYHPDKEER MKAVIEFYVN GKQNALDHFP    420
DGSE*                                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK01156PRK011560.00769245195+
pfam03407Nucleotid_trans5.0e-59179401232+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC83249.1014241426hypothetical protein [Oryza sativa Japonica Group]
GenBankEEC82354.1014241426hypothetical protein OsI_26669 [Oryza sativa Indica Group]
RefSeqNP_001060135.1014241458Os07g0587100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001140234.1014241423hypothetical protein LOC100272274 [Zea mays]
RefSeqXP_002465078.1014243425hypothetical protein SORBIDRAFT_01g031700 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO883664308623690
CK20873033413300
GO8485353001264250
GO883664343623950.028
CK208730502913407.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_62.116evm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Citrus sinensisorange1.1g014357m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna02178.1-v1.0-hybridmrna15113.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.001G015800.1Phvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny