y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g26287.4
FamilyGH33
Protein PropertiesLength: 405 Molecular Weight: 45555.1 Isoelectric Point: 7.3247
ChromosomeChromosome/Scaffold: 1 Start: 21342816 End: 21345776
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33963881.5e-29
  PAGTAPFNSCHASTIVEVEKDNFLVAYFGGSKEGAPDVKIWLQRYGDGYWHPPKVADEQDEVPMWNPVLFKLPSRELLLFYKIGQEVQKWSGAMKRSLDG
  GISWSQREQLPAGILGPIKNKPFLLEDGRLLCGSSVESWNSWGAWLEVTKDAGRTWRKYGPIYVEGETLGVIQPVPYQTANGTIRVLLRSFETIGRVCMA
  DSIDGGVTWSYVHKTELPNPNSGIDGVKMKDGRVLLAYNTFSRGTLKIAISTDDGDSWKEVMTLEDTKGMEFSYPAVIQTMDELVHITYTYNR
Full Sequence
Protein Sequence     Length: 405     Download
MLIHSCCKQQ TGLIATACVL LFFLLLFIFD SPHTIFLKKQ HFHVTVASSR SLREIDTNSR    60
PVHDDSRMED STHNTTNSTA SKMSGWIILK EELTFPAGTA PFNSCHASTI VEVEKDNFLV    120
AYFGGSKEGA PDVKIWLQRY GDGYWHPPKV ADEQDEVPMW NPVLFKLPSR ELLLFYKIGQ    180
EVQKWSGAMK RSLDGGISWS QREQLPAGIL GPIKNKPFLL EDGRLLCGSS VESWNSWGAW    240
LEVTKDAGRT WRKYGPIYVE GETLGVIQPV PYQTANGTIR VLLRSFETIG RVCMADSIDG    300
GVTWSYVHKT ELPNPNSGID GVKMKDGRVL LAYNTFSRGT LKIAISTDDG DSWKEVMTLE    360
DTKGMEFSYP AVIQTMDELV HITYTYNRTQ IKHVVLQPSR IRRL*                    420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00260Sialidase5.0e-6123356274+
COG4692COG46922.0e-33101404359+
pfam13088BNR_21.0e-95116382282+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC82140.1033924412hypothetical protein OsI_26191 [Oryza sativa Indica Group]
GenBankEEC82140.10112401421684hypothetical protein OsI_26191 [Oryza sativa Indica Group]
GenBankEEE67268.103392504912hypothetical protein OsJ_24447 [Oryza sativa Japonica Group]
GenBankEEE67268.101124019211184hypothetical protein OsJ_24447 [Oryza sativa Japonica Group]
RefSeqNP_001059779.1033994419Os07g0516000 [Oryza sativa (japonica cultivar-group)]
Transmembrane Domains
StartEnd
1229
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF3443862621283890
EL689016287973830
FF595784234973300
EY114510262843450
CJ9601792181823990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny