y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g26750.1
FamilyGT1
Protein PropertiesLength: 473 Molecular Weight: 51613.6 Isoelectric Point: 5.6068
ChromosomeChromosome/Scaffold: 1 Start: 21787724 End: 21789466
DescriptionUDP-glucosyl transferase 71B1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11194519.30042e-42
  CTTLFDVTRELGLPAYVYFTSAASMLALMLRLPSLDKEVAVGFEELDGPVNVPGMPPVPAASMPKPMMKKDANYAWFVYHGNRFMDAAGIIVNTVAGLEP
  AILEAIEGGRCVPGERRVPTVYPIGPVMSFKKPTAKEPPHECVRWLEAQPRASVVLLCFGSMGTFAPPQVLEIAEALDRSGHRFLWVLRGPPPGNSPYPT
  DANLGELLPEGFLERTKEKGLVWPKWAPQQEILAHPAVGGFVTHCGWNSTLESLWHGVPLVPWPLYAEQHLNAFELVSVMGVAVAMAVDTKRDNFVEATE
  LERALRSLMDDGSEEGSKAREKAMEAQALCRSA
Full Sequence
Protein Sequence     Length: 473     Download
MAIPTIVLIP FCVTGHLTSM VEAGKRLLSS SSRPLSLTML VTPMSMDKLT SELADIIRRE    60
TESGFEIRFH HLPAVELPQD FHGAEDFISR FVQLHAPGAK AAISGLASPV SAVVMDYFCT    120
TLFDVTRELG LPAYVYFTSA ASMLALMLRL PSLDKEVAVG FEELDGPVNV PGMPPVPAAS    180
MPKPMMKKDA NYAWFVYHGN RFMDAAGIIV NTVAGLEPAI LEAIEGGRCV PGERRVPTVY    240
PIGPVMSFKK PTAKEPPHEC VRWLEAQPRA SVVLLCFGSM GTFAPPQVLE IAEALDRSGH    300
RFLWVLRGPP PGNSPYPTDA NLGELLPEGF LERTKEKGLV WPKWAPQQEI LAHPAVGGFV    360
THCGWNSTLE SLWHGVPLVP WPLYAEQHLN AFELVSVMGV AVAMAVDTKR DNFVEATELE    420
RALRSLMDDG SEEGSKAREK AMEAQALCRS AVEEGGSSYT AWHKLAREVS RD*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02207PLN022071.0e-706469490+
PLN03004PLN030044.0e-771461471+
PLN02167PLN021671.0e-956461478+
PLN02554PLN025542.0e-996469492+
PLN00164PLN0016401471474+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001059731.10547011485Os07g0503900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148983.1024695481anthocyanidin 5,3-O-glucosyltransferase [Zea mays]
RefSeqXP_002436527.1014691477hypothetical protein SORBIDRAFT_10g004230 [Sorghum bicolor]
RefSeqXP_002437877.1014691479hypothetical protein SORBIDRAFT_10g004240 [Sorghum bicolor]
RefSeqXP_002460743.1014701467hypothetical protein SORBIDRAFT_02g034160 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2acv_B0647012462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A0647012462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acw_B0647012462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A0647012462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2vg8_A044587457A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
rose anthocyanin biosynthesisRXN-8005EC-2.4.1UDP-D-glucose:cyanidin 5-O-β-D-glucosyltransferase
rose anthocyanin biosynthesisRXN-8006EC-2.4.1cyanidin 5,3-O-glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV5336612991554510
FL9497522521884390
EE2884372491914390
DV8575682651794420
EC8949182761914580
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00243.1Aquca_020_00570.1Aquca_016_00047.1Aquca_016_00048.1
Arabidopsis lyrata470743887936901945856204481887
481893901948470742898631479701
493362915287333019479703898625
493361342328
Arabidopsis thalianaAT2G29730.1AT1G07260.1AT1G07250.1AT2G29710.1AT2G29740.1
AT2G29750.1AT1G07240.1AT3G21790.1AT3G21800.1AT4G15280.1
AT3G21760.1AT3G21780.1AT4G15260.1AT3G21750.1
Brachypodium distachyonBradi1g26760.1Bradi2g08310.1Bradi1g23110.1Bradi1g24660.1Bradi1g26790.1
Bradi1g26770.1Bradi1g24667.1
Brassica rapaBra015568Bra007812Bra018364Bra018363Bra031559
Bra000471Bra015567Bra039557Bra031303Bra001845
Bra012795Bra001847Bra001846Bra023863Bra031304
Bra031307Bra031310Bra031561Bra031306Bra023861
Carica papayaevm.model.supercontig_8.229evm.model.supercontig_8.271evm.model.supercontig_8.227evm.model.supercontig_8.266evm.model.supercontig_1056.1
Capsella rubellaCarubv10009021mCarubv10009025mCarubv10009037mCarubv10025242mCarubv10023111m
Carubv10016887mCarubv10015440mCarubv10013556mCarubv10007776mCarubv10004730m
Carubv10026313mCarubv10013615mCarubv10013591mCarubv10013590mCarubv10015093m
Carubv10015326mCarubv10016519m
Citrus clementinaCiclev10011659mCiclev10014993mCiclev10013653mCiclev10018337mCiclev10011544m
Ciclev10011522m
Citrus sinensisorange1.1g045570morange1.1g043290morange1.1g011311morange1.1g045029morange1.1g047945m
Cucumis sativusCucsa.058290.1Cucsa.134570.1Cucsa.058370.1Cucsa.058340.1Cucsa.058380.1
Cucsa.058390.1Cucsa.058360.1Cucsa.058400.1Cucsa.058480.1
Eucalyptus grandisEucgr.J01922.1Eucgr.E04316.1Eucgr.E04315.1Eucgr.K01350.1Eucgr.L01241.1
Eucgr.A00945.1Eucgr.A00935.1Eucgr.A00926.1Eucgr.A00940.1Eucgr.A00934.1
Eucgr.A00919.1Eucgr.A00936.1Eucgr.A00938.1Eucgr.A00933.1Eucgr.A00920.1
Eucgr.A00937.1Eucgr.A00927.1Eucgr.A00932.1Eucgr.A00942.1Eucgr.A00947.1
Eucgr.A00930.1Eucgr.A00929.1Eucgr.C01648.1Eucgr.A00948.1Eucgr.A00943.1
Eucgr.A00917.1
Fragaria vescamrna24227.1-v1.0-hybridmrna07876.1-v1.0-hybridmrna22710.1-v1.0-hybridmrna22709.1-v1.0-hybridmrna24696.1-v1.0-hybrid
mrna19965.1-v1.0-hybridmrna24226.1-v1.0-hybridmrna24225.1-v1.0-hybridmrna20181.1-v1.0-hybridmrna24224.1-v1.0-hybrid
mrna22597.1-v1.0-hybridmrna24695.1-v1.0-hybridmrna19964.1-v1.0-hybrid
Glycine maxGlyma02g39080.2Glyma02g39090.2Glyma02g39090.1Glyma14g37170.1Glyma09g09910.1
Glyma02g47990.1
Gossypium raimondiiGorai.009G071600.1Gorai.013G260500.2Gorai.001G214000.1Gorai.003G149300.1Gorai.013G260500.1
Gorai.008G051100.1Gorai.008G051000.1Gorai.005G073700.1Gorai.001G214300.1Gorai.009G071500.1
Gorai.003G123200.1Gorai.008G051000.2Gorai.005G073500.1
Linum usitatissimumLus10026793Lus10039037Lus10026795Lus10036087Lus10027334
Lus10036088Lus10036086Lus10003805Lus10010476
Malus domesticaMDP0000215525MDP0000092033MDP0000163017MDP0000323136MDP0000735095
MDP0000553484MDP0000426138MDP0000715898MDP0000058337MDP0000307237
MDP0000290801MDP0000242552MDP0000306121MDP0000769764MDP0000899508
MDP0000584567MDP0000873295MDP0000806350MDP0000238976MDP0000437996
MDP0000122122
Manihot esculentacassava4.1_032692mcassava4.1_006457mcassava4.1_031134mcassava4.1_031478mcassava4.1_006857m
cassava4.1_007027mcassava4.1_007099mcassava4.1_027138mcassava4.1_007029mcassava4.1_025684m
cassava4.1_018585m
Medicago truncatulaMedtr5g070090.1Medtr5g090670.1Medtr5g070040.1Medtr5g090630.1Medtr5g098930.1
Medtr5g090660.1Medtr5g090620.1Medtr5g090700.1Medtr5g090610.1Medtr5g090580.1
Medtr5g090600.1Medtr5g090690.1
Mimulus guttatusmgv1a005089mmgv1a025629mmgv1a003831mmgv1a023772mmgv1a020444m
mgv1a004831m
Oryza sativaLOC_Os07g32060.1LOC_Os07g32020.1LOC_Os07g31960.1LOC_Os07g32620.1LOC_Os07g37690.1
LOC_Os07g32630.1LOC_Os07g32010.1
Panicum virgatumPavirv00038813mPavirv00046201mPavirv00060850mPavirv00004183mPavirv00042016m
Pavirv00013870mPavirv00052098mPavirv00011477mPavirv00011783mPavirv00046092m
Pavirv00031799mPavirv00064006mPavirv00050397mPavirv00067120mPavirv00059544m
Phaseolus vulgarisPhvul.008G262100.1Phvul.008G262000.1Phvul.009G218800.1Phvul.008G290300.1Phvul.008G290200.1
Populus trichocarpaPotri.016G016900.1Potri.009G044600.1Potri.009G044600.2Potri.016G015700.1Potri.016G015800.1
Potri.006G010000.1Potri.016G014500.1Potri.016G014100.1Potri.016G014400.1Potri.016G014300.1
Potri.016G017300.1Potri.016G014500.2Potri.006G007000.1Potri.016G016500.1Potri.016G017100.1
Potri.016G016000.1Potri.016G017200.1Potri.006G007100.1Potri.006G007300.1Potri.016G016800.1
Potri.014G026300.1Potri.016G017400.1Potri.016G016700.1Potri.016G016300.1Potri.016G016100.1
Potri.016G016200.1Potri.006G007200.1Potri.006G007400.1Potri.016G016400.1Potri.016G017000.1
Potri.006G007600.1
Prunus persicappa004906mppa007869mppa024083mppa018557mppa005052m
ppa005290mppa004957mppa021727mppa005277mppa004725m
ppa025943mppa018805m
Ricinus communis29681.m00133029681.m00133129994.m00046129724.m00084629724.m000844
Setaria italicaSi029670mSi029690mSi031935mSi029664mSi029787m
Si029659mSi032839mSi029729mSi027371m
Sorghum bicolorSb02g034150.1Sb10g004240.1Sb02g034110.1Sb02g034120.1Sb02g034130.1
Sb10g004230.1Sb06g020440.1Sb02g034160.1Sb02g034140.1Sb02g034170.1
Sb02g034100.1Sb02g011220.1Sb07g002380.1
Thellungiella halophilaThhalv10009289mThhalv10007440mThhalv10007519mThhalv10025075mThhalv10020645m
Thhalv10021907mThhalv10020628m
Vitis viniferaGSVIVT01029671001GSVIVT01029680001GSVIVT01015859001GSVIVT01036732001GSVIVT01023095001
GSVIVT01023005001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)