y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g26870.1
FamilyAA2
Protein PropertiesLength: 349 Molecular Weight: 38923 Isoelectric Point: 7.4391
ChromosomeChromosome/Scaffold: 1 Start: 21945071 End: 21946519
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2733290
  IVQAAVNRAIANDYTVAAGLIRLFFHDFAVRGCDGSILIDAPGSERHAAASKTLRGFELIEEIKAKLNARCNNTVSCADILTAATRDASMKVGVPYWSLK
  YGRKDGRDSHAEEADAQVPMGRERVTDLVQFFETRGLNVLDLVILSGAHTIGKASCGAVKRRVLTSKPETLDRKYGDFLLRKCHRGDDAERVELDGESPT
  TFDNRYYQNLERRMGLLETDQGMLEDSRTTRFVKEMAREPEVFKRQFAHSMRQLGEV
Full Sequence
Protein Sequence     Length: 349     Download
MRMRMPRSSV LSFLAVSAFV LAASVTADNY DKGGQQQQNK EACDDQYDRA YHKPAAGLVS    60
EYYGKSCPDM ERIVQAAVNR AIANDYTVAA GLIRLFFHDF AVRGCDGSIL IDAPGSERHA    120
AASKTLRGFE LIEEIKAKLN ARCNNTVSCA DILTAATRDA SMKVGVPYWS LKYGRKDGRD    180
SHAEEADAQV PMGRERVTDL VQFFETRGLN VLDLVILSGA HTIGKASCGA VKRRVLTSKP    240
ETLDRKYGDF LLRKCHRGDD AERVELDGES PTTFDNRYYQ NLERRMGLLE TDQGMLEDSR    300
TTRFVKEMAR EPEVFKRQFA HSMRQLGEVN VLTGDEGEVR YKCSAVNY*                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase3.0e-1366328286+
cd00314plant_peroxidase_like8.0e-2774328289+
pfam00141peroxidase6.0e-5274310238+
PLN03030PLN030304.0e-6162347298+
cd00693secretory_peroxidase7.0e-12757346299+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAH69344.103434732345TPA: class III peroxidase 102 precursor [Oryza sativa (japonica cultivar-group)]
GenBankEAZ39908.103434732328hypothetical protein OsJ_24348 [Oryza sativa Japonica Group]
GenBankEEC82096.103434732328hypothetical protein OsI_26103 [Oryza sativa Indica Group]
RefSeqNP_001059715.103434732345Os07g0499500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002462884.105034853361hypothetical protein SORBIDRAFT_02g033790 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0583473304A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1pa2_A0583473304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0583472294A Chain A, Peanut Peroxidase
PDB1sch_A0583472294A Chain A, Peanut Peroxidase
PDB3hdl_A0623476303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ8243922381043400
HO0612012471043470
CJ8371272021493490
CJ831805207452510
CJ8377832061453490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00303.1
Arabidopsis lyrata473329
Arabidopsis thalianaAT1G30870.1
Brassica rapaBra014895Bra039872Bra023149
Capsella rubellaCarubv10010885m
Citrus clementinaCiclev10006591mCiclev10017746m
Citrus sinensisorange1.1g035963morange1.1g044134m
Cucumis sativusCucsa.118700.1Cucsa.134680.1
Eucalyptus grandisEucgr.F03670.1
Fragaria vescamrna19723.1-v1.0-hybridmrna19930.1-v1.0-hybrid
Glycine maxGlyma08g17300.1Glyma15g16710.1Glyma15g39210.2Glyma09g05340.1
Gossypium raimondiiGorai.011G069800.1
Linum usitatissimumLus10038393Lus10001228
Malus domesticaMDP0000171732MDP0000313080MDP0000190959MDP0000216403MDP0000906162
Manihot esculentacassava4.1_030325mcassava4.1_027488m
Medicago truncatulaMedtr4g133800.1
Mimulus guttatusmgv1a009857mmgv1a023785m
Oryza sativaLOC_Os07g31610.1
Panicum virgatumPavirv00017305mPavirv00018140m
Physcomitrella patensPp1s354_23V6.1
Phaseolus vulgarisPhvul.005G046000.1Phvul.009G244500.1
Picea abiesMA_44564g0010MA_10201061g0010MA_125874g0020
Populus trichocarpaPotri.010G175100.1Potri.003G156100.1
Prunus persicappa023679mppa017551m
Setaria italicaSi030295m
Sorghum bicolorSb02g033790.1
Thellungiella halophilaThhalv10008077m
Vitis viniferaGSVIVT01010080001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny