y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g28366.1
FamilyGH95
Protein PropertiesLength: 819 Molecular Weight: 90371.3 Isoelectric Point: 6.0439
ChromosomeChromosome/Scaffold: 1 Start: 23588380 End: 23594617
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95177850
  EERPLKVVFASPAEHFTDAAPIGNGSLGAMVWGGVASEKLQLNLDTLWTGVPGNYTDPSVPSAVAVVRKLVHDRQFVDATNAASGLYGGPTEVYQPLGDV
  NIEFGTSSQDYSSYKRELDLHTATVLVTYNIGEVQYTREHFCSNPHQVIVTKLSANKSGHISCTLSLDSKLTHSVRVTNANEMIMDGTCPGQRHVLQQNE
  TNDATGIKFTAVLSLQMGGAMAKAEVLNDHNLRIDNADWVLLLVTAASSFSGPFINPSNSKIDPESVALRNLNMSRNVTFDQLKAAHLKDYQGLFHRVSL
  ILSHAPAIEKTNLNETGEAIKITAERVNSFRSNEDPSLVELLFQYGRYLLISCSRPGTQVSNLQGIWNQDLSPAWQSAPHLNINLQMNYWPTLPCNLGEC
  QEPLIDFIAALAVNGTKTAKINYQTSGWVTHHVSDIWAKSSAFNEDAKYAVWPMGGAWLCTHLWEHYQYSLDKEFLKNTAYPLLEGCALFLADWLTEGRN
  GYLETNPSISPEHSFIAPDSGGQQASVSYSTTMDVSIIREIFMAIISSAEVLGKSDSTLVPKIKKALSRLTPIMIAKDHTIMEWAQDFEDPEVHHRHLSH
  LFGLYPGHTITMQKNPGICEAVANSLYKRGEDGPGWSSTWKMALWARLLNSQNAYRMILKLITLVPPGDDVQFEGGLYSNLWTAHPPFQIDANFGFTAAV
  AEMLLQSSLTDLYLLPALPRDKWPEGCVKGLRARGDTTVNICWGKQELQEAVLWSNNRNSSVIRLHYGE
Full Sequence
Protein Sequence     Length: 819     Download
MDDGGRIPAR PTTAEGEERP LKVVFASPAE HFTDAAPIGN GSLGAMVWGG VASEKLQLNL    60
DTLWTGVPGN YTDPSVPSAV AVVRKLVHDR QFVDATNAAS GLYGGPTEVY QPLGDVNIEF    120
GTSSQDYSSY KRELDLHTAT VLVTYNIGEV QYTREHFCSN PHQVIVTKLS ANKSGHISCT    180
LSLDSKLTHS VRVTNANEMI MDGTCPGQRH VLQQNETNDA TGIKFTAVLS LQMGGAMAKA    240
EVLNDHNLRI DNADWVLLLV TAASSFSGPF INPSNSKIDP ESVALRNLNM SRNVTFDQLK    300
AAHLKDYQGL FHRVSLILSH APAIEKTNLN ETGEAIKITA ERVNSFRSNE DPSLVELLFQ    360
YGRYLLISCS RPGTQVSNLQ GIWNQDLSPA WQSAPHLNIN LQMNYWPTLP CNLGECQEPL    420
IDFIAALAVN GTKTAKINYQ TSGWVTHHVS DIWAKSSAFN EDAKYAVWPM GGAWLCTHLW    480
EHYQYSLDKE FLKNTAYPLL EGCALFLADW LTEGRNGYLE TNPSISPEHS FIAPDSGGQQ    540
ASVSYSTTMD VSIIREIFMA IISSAEVLGK SDSTLVPKIK KALSRLTPIM IAKDHTIMEW    600
AQDFEDPEVH HRHLSHLFGL YPGHTITMQK NPGICEAVAN SLYKRGEDGP GWSSTWKMAL    660
WARLLNSQNA YRMILKLITL VPPGDDVQFE GGLYSNLWTA HPPFQIDANF GFTAAVAEML    720
LQSSLTDLYL LPALPRDKWP EGCVKGLRAR GDTTVNICWG KQELQEAVLW SNNRNSSVIR    780
LHYGERVTEA TVAAGIVYKF NGDLQCVETR PLDKCAFN*                           840
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABG66022.1038094811large secreted protein, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABG66023.101088092704large secreted protein, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEC79728.1038094811hypothetical protein OsI_21058 [Oryza sativa Indica Group]
RefSeqNP_001064381.101380927848Os10g0339600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002461732.101076932832hypothetical protein SORBIDRAFT_02g007180 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0217903763A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0217903763A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B03778453854A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A03778453854A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B03778453854A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8946642643936560
GO8766213484698160
EX2638603023806810
CN0129622493946420
FD5277722322765070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)