y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g28847.1
FamilyGH116
Protein PropertiesLength: 604 Molecular Weight: 68262.3 Isoelectric Point: 5.1758
ChromosomeChromosome/Scaffold: 1 Start: 24203767 End: 24209069
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1161875490
  GKFLYLEGVEYFMWCTYDVHFYASFALLNLFPKIELSIQRDFARAVLREDRSRVRFLADGTWGTRKVIGAVPHDLGAHDPWHELNAYNIHDTSRWKDLNP
  KFVLQVYRDFAATGDMSFGKDVWPAVCTAMEYMEQFDRDGDGMIENDGFPDQTYDAWTVLGVSAYCGCLWLASLQAAAAMARGLGHNDYAERCMVKFAKA
  KHVFETKLWNGSYFNYDSGASYSSRSIQADQLAGQWYAASSGLPPLFDEGRIKCTLQKIFDYNVMRVKGGRMGAVNGMYPNGKVDETCMQSREIWTGVTY
  SLAATMLLHGMEDQAFTTAEGIFLAGWSEEGYGYWFQTPEAWTIDGHYRSLIYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 604     Download
MWGTIVQDGC FDRDNFKAGP SMPSSLGETV CAAVCASTWV EAHGRCTVVF ALAWSSPEVK    60
FKKGSTYHRR YTKFYGTSPR SAINLVQDAL MSYKHWEEEI DKWQTPILRD ERLPEWYKIT    120
LFNELYFLVA GGTVWIDSES LMVDADKKVN SSLPEDSDLP LHDSNCNSTV PLIDPMPLDF    180
DDKENVGKFL YLEGVEYFMW CTYDVHFYAS FALLNLFPKI ELSIQRDFAR AVLREDRSRV    240
RFLADGTWGT RKVIGAVPHD LGAHDPWHEL NAYNIHDTSR WKDLNPKFVL QVYRDFAATG    300
DMSFGKDVWP AVCTAMEYME QFDRDGDGMI ENDGFPDQTY DAWTVLGVSA YCGCLWLASL    360
QAAAAMARGL GHNDYAERCM VKFAKAKHVF ETKLWNGSYF NYDSGASYSS RSIQADQLAG    420
QWYAASSGLP PLFDEGRIKC TLQKIFDYNV MRVKGGRMGA VNGMYPNGKV DETCMQSREI    480
WTGVTYSLAA TMLLHGMEDQ AFTTAEGIFL AGWSEEGYGY WFQTPEAWTI DGHYRSLIYM    540
RPLAIWAMQY ALSPPKAILE APKVNTMDRA HISPGALQFL QDSVRKITPK NGCFGSNVFN    600
CDC*                                                                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB19.0e-5255419190+
pfam12215GBA2_N7.0e-1029696+
COG4354COG43541.0e-8150552521+
pfam04685DUF6081.0e-157187550367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC67156.101603326974hypothetical protein OsI_34005 [Oryza sativa Indica Group]
GenBankEEC81952.101603247850hypothetical protein OsI_25831 [Oryza sativa Indica Group]
GenBankEEE67087.101603247838hypothetical protein OsJ_24071 [Oryza sativa Japonica Group]
RefSeqNP_001146319.1016031649hypothetical protein LOC100279895 [Zea mays]
RefSeqXP_002489100.1016031603hypothetical protein SORBIDRAFT_0073s002050 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0515213322395700
GT0327923252395630
GT0338833341274600
HO7798602793296040
HO7798601741583300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)