y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g29570.1
FamilyGT4
Protein PropertiesLength: 865 Molecular Weight: 98932.5 Isoelectric Point: 8.2366
ChromosomeChromosome/Scaffold: 1 Start: 25125430 End: 25129991
Descriptionsucrose synthase 6
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45727390
  DRNKPIIFSMARLDKVKNITGLVEWYGQNKKVRDLVNLVVVAGLLNASQSKDREEIDEINKMHNLIDKYQLKGQIRWIKAQTDRVRNGELYRYIADTKGA
  FVQPALYEAFGLTVIEAMNCGLPTFATNQGGPAEIIVDGVSGFHINPMNGREAGNKIADFFQKCKEDP
Full Sequence
Protein Sequence     Length: 865     Download
MASKLSFKRM DSVAESMPDA LRQSRYQMKR CFQRYVSKGR RLLKNQQLME ELEKSLDDKV    60
EKEKLVEGFL GYIICSTQEA VVLPPFVAFA VRMNPGIWEY VKVHSDDLSV EGITPSEYLK    120
FKETLYDEKW AKDDNSLEID FGALDLSTPH LTLPSSIGNG MQFVSKFMSS KLSGKPESMK    180
PLLDYLLALN YRGEKLMVND TIDTVNKLQT ALLLAEVFVS GLPKYTPYLK FEQRFQEWGL    240
EKGWGENAER CKETLNFLSE VLQAPDPINM EKFFSRVPSI FNIVVFSIHG YFGQEKVLGL    300
PDTGGQVVYI LDQVRSMEEE LLQRIKQQGL NVTPKILVLT RLIPDSKGTK CNVELEPVEN    360
TQYSHILRVP FKTEDGKDLR QWVSRFDIYP YLERYAQDAS VKILDMLEGK PDLIIGNYTD    420
GNLVASLMSS KLGVTQGTIA HALEKTKYED SDVKWRELDQ KYHFSCQFTA DMIAMNTTDF    480
IITSTYQEIA GSKEKPGQYE HHYAFTMPGL CRYATGINVF DPKFNIAAPG ADQSVYFPYT    540
QKQKRLTGLH PQIEELLYSK EDTDEHIGYL ADRNKPIIFS MARLDKVKNI TGLVEWYGQN    600
KKVRDLVNLV VVAGLLNASQ SKDREEIDEI NKMHNLIDKY QLKGQIRWIK AQTDRVRNGE    660
LYRYIADTKG AFVQPALYEA FGLTVIEAMN CGLPTFATNQ GGPAEIIVDG VSGFHINPMN    720
GREAGNKIAD FFQKCKEDPS YWNKVSTAGL QRIYECYTWK IYATKVLNMG SMYGFWRTLN    780
KEEKVAKQRY IQMFYNLQFR NLVKTVPRVG EQPPRTAAST STGMVAPNEI VLRPKERKPQ    840
NRMQRIMTSL LGPKPPTYEQ NSYR*                                          900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02472sucr_P_syn_N2.0e-59283769495+
cd03800GT1_Sucrose_synthase8.0e-110282767487+
PLN00142PLN0014201815815+
TIGR02470sucr_synth025808784+
pfam00862Sucrose_synth09559551+
Gene Ontology
GO TermDescription
GO:0005985sucrose metabolic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE03896.2018591855OSJNBb0026I12.4 [Oryza sativa (japonica cultivar-group)]
EMBLCAH66603.1018591855H0211A12.6 [Oryza sativa (indica cultivar-group)]
GenBankEEC76883.1018591855hypothetical protein OsI_15088 [Oryza sativa Indica Group]
GenBankEEE60617.1018381826hypothetical protein OsJ_14034 [Oryza sativa Japonica Group]
RefSeqNP_001052432.1018591844Os04g0309600 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s29_H0980710803A Chain A, Pectin Methylesterase From Carrot
PDB3s29_G0980710803A Chain A, Pectin Methylesterase From Carrot
PDB3s29_F0980710803A Chain A, Pectin Methylesterase From Carrot
PDB3s29_E0980710803A Chain A, Pectin Methylesterase From Carrot
PDB3s29_D0980710803A Chain A, Pectin Methylesterase From Carrot
Metabolic Pathways
Pathway NameReactionECProtein Name
galactose degradation IIISUCROSE-SYNTHASE-RXNEC-2.4.1.13sucrose synthase
sucrose degradation IIISUCROSE-SYNTHASE-RXNEC-2.4.1.13sucrose synthase
UDP-glucose biosynthesis (from sucrose)SUCROSE-SYNTHASE-RXNEC-2.4.1.13sucrose synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79451979998070
BU10368381078160
CX1090546011047040
FG2273164552807340
GO854345321293490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00099.3Aquca_034_00099.2Aquca_034_00099.1Aquca_011_00228.1Aquca_114_00017.1
Aquca_020_00040.3Aquca_020_00040.2Aquca_020_00040.1Aquca_002_01365.2Aquca_002_01365.1
Aquca_020_00566.4Aquca_020_00566.3Aquca_020_00566.2Aquca_020_00566.1Aquca_003_00666.4
Aquca_003_00666.2Aquca_003_00666.1Aquca_003_00666.3
Arabidopsis lyrata470477487943489859488935494980
316284484788910122493691
Arabidopsis thalianaAT1G04920.1AT5G11110.1AT4G10120.2AT4G10120.1AT5G20280.1
AT5G49190.1AT1G73370.2AT1G73370.1AT3G43190.1AT5G20830.2
AT5G20830.1AT5G37180.1AT4G02280.1
Brachypodium distachyonBradi2g58860.1Bradi3g20120.1Bradi4g21750.1Bradi3g06217.1Bradi1g30520.1
Bradi3g60687.1Bradi1g46670.3Bradi1g46670.1Bradi1g62957.1Bradi1g60320.3
Bradi1g60320.2Bradi1g60320.1Bradi1g20890.1
Brassica rapaBra015364Bra033195Bra009830Bra006090Bra002289
Bra020096Bra037432Bra003845Bra006578Bra002332
Bra015995Bra039502Bra036282
Carica papayaevm.model.supercontig_46.57evm.model.supercontig_142.9evm.model.supercontig_83.22evm.model.supercontig_217.19evm.model.supercontig_82.65
evm.model.supercontig_178.35evm.model.supercontig_50.160evm.TU.contig_29609.1
Capsella rubellaCarubv10008160mCarubv10000113mCarubv10000112mCarubv10025867mCarubv10019738m
Carubv10000208mCarubv10016702mCarubv10006192mCarubv10000249m
Chlamydomonas reinhardtiiCre12.g524000.t1.2
Citrus clementinaCiclev10004221mCiclev10007311mCiclev10018655mCiclev10007312mCiclev10004341m
Ciclev10007488mCiclev10007487mCiclev10007486mCiclev10007485mCiclev10007484m
Ciclev10007483mCiclev10007482mCiclev10007481mCiclev10007480mCiclev10010343m
Ciclev10011062mCiclev10018889mCiclev10019255mCiclev10024638m
Citrus sinensisorange1.1g001492morange1.1g002660morange1.1g001541morange1.1g001705morange1.1g002665m
orange1.1g001557morange1.1g003726morange1.1g003962morange1.1g003661morange1.1g003657m
orange1.1g003656morange1.1g003655morange1.1g003652morange1.1g003647morange1.1g003646m
orange1.1g003947morange1.1g002909morange1.1g036539morange1.1g006524morange1.1g005444m
orange1.1g003987morange1.1g003985morange1.1g003636morange1.1g003552morange1.1g003549m
orange1.1g003492morange1.1g005365m
Cucumis sativusCucsa.266070.1Cucsa.249370.2Cucsa.249370.1Cucsa.088480.1Cucsa.173660.1
Cucsa.112470.1Cucsa.142060.2Cucsa.142060.1Cucsa.096950.1
Eucalyptus grandisEucgr.H00041.1Eucgr.F02931.1Eucgr.C01715.1Eucgr.E03524.1Eucgr.E03528.1
Eucgr.C03205.1Eucgr.C03199.1Eucgr.C03201.1Eucgr.C03204.1Eucgr.K03505.1
Eucgr.J01640.3Eucgr.J01640.2Eucgr.J01640.1Eucgr.K02305.2Eucgr.K02305.1
Eucgr.H01094.2Eucgr.H01094.1Eucgr.C00769.1Eucgr.C03207.1Eucgr.F01010.1
Eucgr.H03515.1Eucgr.B01577.1Eucgr.H03496.1
Fragaria vescamrna06523.1-v1.0-hybridmrna31122.1-v1.0-hybridmrna31164.1-v1.0-hybridmrna11606.1-v1.0-hybridmrna07050.1-v1.0-hybrid
mrna12940.1-v1.0-hybridmrna11429.1-v1.0-hybridmrna31666.1-v1.0-hybridmrna11077.1-v1.0-hybridmrna09290.1-v1.0-hybrid
Glycine maxGlyma14g03300.1Glyma06g48200.1Glyma08g42140.1Glyma18g12890.1Glyma17g11820.1
Glyma13g23060.2Glyma13g23060.1Glyma04g12220.2Glyma15g16171.2Glyma15g16171.1
Glyma11g33240.1Glyma17g05067.2Glyma17g05067.1Glyma15g20180.3Glyma15g20180.2
Glyma15g20180.1Glyma13g17421.4Glyma13g17421.3Glyma13g17421.1Glyma09g08550.6
Glyma09g08550.5Glyma09g08550.4Glyma09g08550.1Glyma14g39070.1Glyma02g40740.1
Glyma19g40041.2Glyma19g40041.1Glyma03g37441.2Glyma03g37441.1Glyma16g34290.2
Glyma16g34290.1Glyma09g29710.1
Gossypium raimondiiGorai.011G155900.4Gorai.011G155900.3Gorai.011G155900.2Gorai.011G155900.1Gorai.009G262100.2
Gorai.009G262100.1Gorai.010G116100.2Gorai.010G116100.1Gorai.013G235900.1Gorai.004G292800.2
Gorai.004G292800.1Gorai.009G038000.7Gorai.009G038000.6Gorai.009G038000.4Gorai.009G038000.3
Gorai.009G038000.2Gorai.009G038000.1Gorai.013G222400.2Gorai.013G222400.1Gorai.001G017700.1
Gorai.007G047100.1Gorai.010G092300.5Gorai.010G092300.4Gorai.010G092300.3Gorai.010G092300.2
Gorai.010G092300.1Gorai.010G091800.2Gorai.010G091800.1Gorai.001G083400.4Gorai.001G083400.3
Gorai.001G083400.2Gorai.001G083400.1Gorai.004G142700.3Gorai.004G142700.2Gorai.004G142700.1
Linum usitatissimumLus10016657Lus10038119Lus10008056Lus10041041Lus10022570
Lus10006184Lus10020506Lus10012454Lus10017984Lus10007372
Lus10020791Lus10001468Lus10041979Lus10013417Lus10010308
Lus10008206
Malus domesticaMDP0000288684MDP0000783676MDP0000256965MDP0000137330MDP0000306580
MDP0000288876MDP0000174537MDP0000293214MDP0000581406MDP0000161129
MDP0000250070MDP0000215889MDP0000277711MDP0000287311MDP0000872262
MDP0000415558MDP0000132527MDP0000293649MDP0000160578MDP0000204871
MDP0000126946MDP0000204870MDP0000212593MDP0000188551MDP0000138004
MDP0000252802
Manihot esculentacassava4.1_000839mcassava4.1_000827mcassava4.1_024105mcassava4.1_001415mcassava4.1_000867m
cassava4.1_000744mcassava4.1_001062mcassava4.1_000732mcassava4.1_002265mcassava4.1_001912m
cassava4.1_001871mcassava4.1_001867mcassava4.1_001864mcassava4.1_001874mcassava4.1_001283m
cassava4.1_027790mcassava4.1_002238mcassava4.1_001840mcassava4.1_026466m
Medicago truncatulaMedtr5g091340.1Medtr3g047380.1Medtr4g115620.1Medtr4g124660.4Medtr4g124660.3
Medtr4g124660.2Medtr4g124660.1Medtr3g064610.1Medtr5g076830.1Medtr1g088170.1
Medtr6g081120.1Medtr6g081200.1Medtr6g081180.1
Mimulus guttatusmgv1a000579mmgv1a000604mmgv1a000596mmgv1a000621mmgv1a001291m
mgv1a024320mmgv1a002736mmgv1a001481mmgv1a001207m
Oryza sativaLOC_Os01g69030.4LOC_Os01g69030.3LOC_Os01g69030.2LOC_Os01g69030.1LOC_Os11g12810.1
LOC_Os08g20660.2LOC_Os08g20660.1LOC_Os02g09170.2LOC_Os02g09170.1LOC_Os06g43630.1
LOC_Os02g58480.1LOC_Os04g24430.1LOC_Os04g17650.1LOC_Os06g09450.8LOC_Os06g09450.7
LOC_Os06g09450.6LOC_Os06g09450.5LOC_Os06g09450.4LOC_Os06g09450.3LOC_Os06g09450.2
LOC_Os06g09450.1LOC_Os03g22120.3LOC_Os03g22120.1LOC_Os03g28330.4LOC_Os03g28330.3
LOC_Os03g28330.2LOC_Os03g28330.1LOC_Os07g42490.2LOC_Os07g42490.1
Panicum virgatumPavirv00017689mPavirv00015422mPavirv00021568mPavirv00021567mPavirv00021566m
Pavirv00040314mPavirv00068375mPavirv00009592mPavirv00069185mPavirv00025176m
Pavirv00065876mPavirv00061751mPavirv00054750mPavirv00054749mPavirv00031455m
Pavirv00032661mPavirv00046633mPavirv00046632mPavirv00046631mPavirv00047139m
Pavirv00026880mPavirv00026879mPavirv00022656m
Physcomitrella patensPp1s66_227V6.1Pp1s131_107V6.1Pp1s120_66V6.1Pp1s28_394V6.2Pp1s28_394V6.1
Pp1s93_98V6.1Pp1s303_45V6.1
Phaseolus vulgarisPhvul.006G031700.1Phvul.005G002600.1Phvul.003G170100.1Phvul.009G250800.1Phvul.006G087300.1
Phvul.003G127500.1Phvul.009G223800.2Phvul.009G223800.1Phvul.008G241300.1Phvul.001G209600.2
Phvul.001G209600.1Phvul.004G142800.1
Picea abiesMA_10743g0010MA_103595g0010MA_10432412g0010MA_10427170g0010MA_10430807g0030
MA_319g0010MA_10432094g0010MA_113423g0010MA_27253g0010MA_10429251g0010
MA_127762g0010
Populus trichocarpaPotri.013G095500.2Potri.013G095500.1Potri.017G057800.1Potri.001G317600.1Potri.018G124700.4
Potri.018G124700.3Potri.018G124700.1Potri.018G124700.2Potri.018G025100.2Potri.018G025100.1
Potri.001G317600.2Potri.006G064300.2Potri.006G064300.1Potri.006G136700.2Potri.006G136700.1
Potri.015G029100.3Potri.015G029100.2Potri.015G029100.1Potri.018G063500.2Potri.018G063500.1
Potri.012G037200.2Potri.012G037200.1Potri.004G081300.2Potri.004G081300.1Potri.017G139100.3
Potri.017G139100.2Potri.017G139100.1Potri.002G202300.1Potri.014G126800.1
Prunus persicappa000622mppa000639mppa000636mppa000716mppa001573m
ppa001537mppa001535mppa017606mppa001845mppa001135m
ppa002723m
Ricinus communis28543.m00038429904.m00290330074.m00133629848.m00459929739.m003693
29660.m00076129951.m00014329726.m00408629986.m001646
Setaria italicaSi000130mSi025907mSi013170mSi013169mSi016229m
Si005825mSi005783mSi005845mSi020148mSi034293m
Si005882mSi005881mSi005880mSi005859mSi034282m
Si034281mSi034280mSi034279m
Selaginella moellendorffii1484192020591988268237
Sorghum bicolorSb03g043900.1Sb05g007310.1Sb09g028570.1Sb04g005720.1Sb10g025240.1
Sb10g031040.2Sb10g031040.1Sb01g035890.1Sb10g006330.3Sb10g006330.2
Sb10g006330.1Sb01g033060.1Sb04g038410.1
Thellungiella halophilaThhalv10006639mThhalv10028384mThhalv10012643mThhalv10012540mThhalv10012539m
Thhalv10003667mThhalv10018094mThhalv10012719mThhalv10027639mThhalv10028457m
Thhalv10028435m
Vitis viniferaGSVIVT01020928001GSVIVT01037186001GSVIVT01012825001GSVIVT01035882001GSVIVT01034794001
GSVIVT01035106001GSVIVT01029388001GSVIVT01015018001GSVIVT01035210001GSVIVT01028043001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)