y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g29622.1
FamilyGT48
Protein PropertiesLength: 1966 Molecular Weight: 226117 Isoelectric Point: 9.3271
ChromosomeChromosome/Scaffold: 1 Start: 25162279 End: 25175875
Descriptionglucan synthase-like 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48107318210
  VPTNLDARRRISFFANSLFMEMPNAPEVRNMLPFSVLTPYYKEDVLFSLHNLEEPNEDGVSILFYLQKIYPDEWKNFLERVDRKTEEEVREDETLEDELR
  LWASYRGQTLTRTVRGMMYYRKALELQGFLDMAKDDDLMKGYRATELMSEESPLMTQCKAIADMKFTYVVSCQQYGIQKRSNDPCAHDILRLMTTYPSLR
  VAYIDEVEAPSQDRIKKIDKVYYSVLVKASVTKPNDPGQSLDQVIYKIKLPGNAILGEGKPENQNHAIIFTRGECLQTIDMNQEHYMEEALKMRNLLQEF
  LEKHDGVRYPSILGVREHIFTGSVSSLAWFMSNQETSFVTIGQRVLANPLRVRFHYGHPDIFDRLFHLTRGGISKASKIINLSEDIFAGFNSTLRGGNVT
  HHEYMQVGKGRDVGLNQISLFEAKIANGNGEQTLSRDIYRLGHRFDFFRMLSCYYTTIGFYFSTMITVWTVYVFLYGRLYLVLSGLDEALATGKRFVHNS
  PLQVALASESFVQLGFLMALPMMMEIGLERGFRTALSDFVLMQLQLASVFFTFSLGTKTHYYGRTLLHGGAEYRATGRGFVVFHAKFAENYRLYSRSHFV
  KGIELMILLVVYEIFGQSYRGAITYIFITVSMWFMVGTWLFAPFLFNPSGFEWQKIVDDWTDWNKWIHNRGGIGVAPEKSWESWWDKEQGPLRHSGKRGT
  VVEILLALRFFIYQYGLVYHLNITKQYNKSVLVYGISWVVIFSMLLVMK
Full Sequence
Protein Sequence     Length: 1966     Download
MAAPGRRADF SSSSAQSPGP SPAGASGGGG GGRRLLRTQT VGGNMGESIF DSEVVPSSLV    60
EIAPILRVAN EVEAGNPRVA YLCRFYAFEK AHRLDPNSSG RGVRQFKTAL LQRLERENDP    120
TLKGRVHQSD AREMQRFYRE YYKKYIHALQ SAADKADRAL LTKAYQTAAV LFEVLKAVNV    180
SQSVEVDQAI LDTHNKIEEK KKLYVPYNIL PLDPESTDEA IMQYPEIRAS VYALRNTRGL    240
PWPKENEKKP DEKKTDKDLL DWLQAMFGFQ KDNVSNQREH LILLLANVHI RQIPKPDQQS    300
KLDDRALDAV MKRLFKNYKM WCKYLGRKSS LWLPTIQQEV QQRKLLYMGL YLLIWGEAAN    360
LRFMPECLCY IYHHMAFELY GMLAGNVSPM TGENVKPAYG GDEEAFLMKI VTPIYKVIEE    420
EAHRSKTMKS KHSHWRNYDD LNEYFWKVDC FRLGWPMRAD ADFFKTPKLA YPNRLNGEER    480
SAGSVHWMGK INFVEIRSFW HIFRSFDRMW IFLILSLQAM VIIAWNGGTP SDIFDSGVLQ    540
QVLSIFITAA VLKLGQATLD IVFGWKARTN MSFARKLRYV LKLVSAAAWV VILPVTYAYT    600
WTNPTGLART IKDWLGNGHQ PSLYILAVVV YLAPNMLASG LFLFPCIRRY LESSNFKVIT    660
FMMWWSQPRV FVGRGMHEGP FSLFKYTMFW VLLLAMKLTV SFYIEIKPLV QPTKDIMGTP    720
IRTFQWHEFF PHANNNIGVV IALWAPIILV YFMDTQIWYA VFSTLVGGIY GACRRLGEIR    780
TLGMLRYRFE SLPDAFNKWL IPSDAHKRKG FRAAFSTKPS KSPSDEQEIE KRAARFAQMW    840
NLIITSFREE DLIDNREMDL LLVPYCKDRE LNIFQWPPFL LASKIPIALD MAADSGGKDR    900
DLNKRMGSDP YFSYAIRECY ASFKNIINTL VSGQREKVVM QEIFTVVEKH INEGTLIKDL    960
HMRNLPALSK KLIELLELLQ TNKEEDKGQV VILFQDMLEV VTRDIMEDQE LGGVLDSIHG    1020
GNSRKHEGMT PLDQQDQLFT KAIKFPVVES NAWTEKIKRL QLLLTVKESA MDVPTNLDAR    1080
RRISFFANSL FMEMPNAPEV RNMLPFSVLT PYYKEDVLFS LHNLEEPNED GVSILFYLQK    1140
IYPDEWKNFL ERVDRKTEEE VREDETLEDE LRLWASYRGQ TLTRTVRGMM YYRKALELQG    1200
FLDMAKDDDL MKGYRATELM SEESPLMTQC KAIADMKFTY VVSCQQYGIQ KRSNDPCAHD    1260
ILRLMTTYPS LRVAYIDEVE APSQDRIKKI DKVYYSVLVK ASVTKPNDPG QSLDQVIYKI    1320
KLPGNAILGE GKPENQNHAI IFTRGECLQT IDMNQEHYME EALKMRNLLQ EFLEKHDGVR    1380
YPSILGVREH IFTGSVSSLA WFMSNQETSF VTIGQRVLAN PLRVRFHYGH PDIFDRLFHL    1440
TRGGISKASK IINLSEDIFA GFNSTLRGGN VTHHEYMQVG KGRDVGLNQI SLFEAKIANG    1500
NGEQTLSRDI YRLGHRFDFF RMLSCYYTTI GFYFSTMITV WTVYVFLYGR LYLVLSGLDE    1560
ALATGKRFVH NSPLQVALAS ESFVQLGFLM ALPMMMEIGL ERGFRTALSD FVLMQLQLAS    1620
VFFTFSLGTK THYYGRTLLH GGAEYRATGR GFVVFHAKFA ENYRLYSRSH FVKGIELMIL    1680
LVVYEIFGQS YRGAITYIFI TVSMWFMVGT WLFAPFLFNP SGFEWQKIVD DWTDWNKWIH    1740
NRGGIGVAPE KSWESWWDKE QGPLRHSGKR GTVVEILLAL RFFIYQYGLV YHLNITKQYN    1800
KSVLVYGISW VVIFSMLLVM KTVSVGRRRF SAEFQLVFRL MKGLIFISFI STIVILIALA    1860
HMTVLDIFVC ILAFMPTGWG LLLIAQAIKP VVEMVGLWGS VKALARGYEI LMGLLLFTPI    1920
AFLAWFPFVS EFQTRMLFNQ AFSRGLQISR ILGGHKKDRA TRNKE*                   1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6054.0e-962176125+
pfam14288FKS1_dom12.0e-54342458118+
pfam02364Glucan_synthase010731814817+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD23015.10331965351969putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group]
DDBJBAD62105.101196511959putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group]
GenBankEEE66395.101196511982hypothetical protein OsJ_22734 [Oryza sativa Japonica Group]
RefSeqXP_002439067.101196511965hypothetical protein SORBIDRAFT_10g030970 [Sorghum bicolor]
RefSeqXP_002453103.10211965141942hypothetical protein SORBIDRAFT_04g038510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lxm_A0.016617521128B Chain B, Lip5-chmp5
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
510529
542564
579601
622644
686704
737759
15261548
15741596
16111628
16931715
17731795
18021821
18361858
18651887
19071929
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519630133419570
HO780496341138917290
HO780496133125813880
HO780496206171419190
GO837585304137116740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g76617.1Bradi2g46250.1Bradi2g40460.1
Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)