y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g29784.1
FamilyGT8
Protein PropertiesLength: 716 Molecular Weight: 82404.7 Isoelectric Point: 7.9601
ChromosomeChromosome/Scaffold: 1 Start: 25292752 End: 25295857
Descriptiongalacturonosyltransferase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT83666870
  MQLITDYYFRDGVIKEYFHDAALKDEEDKAKLEDRSLYHYAIFSDNVLAASVVVRSTVTHAKEPEKHVFHIVTDSLNFAAMKMWFISHSPRPATVHVESI
  NNFKWLNSSYCSAMRQLESARLKEYYFKAHDPSSLSDGTENLKYRNPKYLSMLNHLRFYMPEIHPKLDKILFLDDDVVVQKDLTPLWDVDLKGMVNGAVE
  TCKESFHRFDTYLNFSHPKISENFDPRACGWAFGMNVFDLKEWKKRNITGIYHYWQDLNEGRKLWKLGTLPPGLITFYNLTYPLDRTWHVLGLGYDPAVD
  IAEIDNAAVVHYNGNYKPWLDL
Full Sequence
Protein Sequence     Length: 716     Download
MAFPSISPTS AAAWRRRSGF LALLLLLLFL SFQVVVHVPS IRSAVSLWLF SGHRRQPQRE    60
GPRSGDLQDV EDFNKMVAYT DQDGRIRLFR VTAREFASSS IWENPLLPQE SHPVAGTQEN    120
AEEQLLATGS EDANLSSAAV SASQRTDPIK LKREVNHFLS TGDFGPLPNW SALCHSSLFI    180
VTPWFLQIFR RRRKEQRIQE LLNMDKEVEL HMRNTATNSS RNFDNKVKVS YNIWRQEFHH    240
TNTDSTLKLM KDQIIMAKVY ATIARSQNET DLHTSLMKCI KESKAAIGDA NMDSELDSSA    300
LERAKEMGHV LSSARDVLYN SDEVSRRLRV MLQSAELNID TAKKQNTFLV QHAAKTVPMP    360
LHCLHMQLIT DYYFRDGVIK EYFHDAALKD EEDKAKLEDR SLYHYAIFSD NVLAASVVVR    420
STVTHAKEPE KHVFHIVTDS LNFAAMKMWF ISHSPRPATV HVESINNFKW LNSSYCSAMR    480
QLESARLKEY YFKAHDPSSL SDGTENLKYR NPKYLSMLNH LRFYMPEIHP KLDKILFLDD    540
DVVVQKDLTP LWDVDLKGMV NGAVETCKES FHRFDTYLNF SHPKISENFD PRACGWAFGM    600
NVFDLKEWKK RNITGIYHYW QDLNEGRKLW KLGTLPPGLI TFYNLTYPLD RTWHVLGLGY    660
DPAVDIAEID NAAVVHYNGN YKPWLDLAIS KYKAYWSKYV DVDSSHIRHC YASKQ*        720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02718PLN027188.0e-158243710475+
PLN02523PLN025235.0e-178241710489+
PLN02910PLN02910065714652+
PLN02829PLN028290244710467+
PLN02742PLN027420252710468+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM18739.1018871584611AC092548_17 hypothetical protein [Oryza sativa Japonica Group]
GenBankABB47337.1017151686Glycosyltransferase QUASIMODO1, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEAY78177.106871564677hypothetical protein OsI_33224 [Oryza sativa Indica Group]
GenBankEAZ15816.106871577690hypothetical protein OsJ_31235 [Oryza sativa Japonica Group]
RefSeqXP_002439065.103771550697hypothetical protein SORBIDRAFT_10g030870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.0000651168475252A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB1g9r_A0.0000651168475252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.000251162075176A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan biosynthesis2.4.1.43-RXNEC-2.4.1.43polygalacturonate 4-α-galacturonosyltransferase
Transmembrane Domains
StartEnd
1941
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8809962913055950
JG8778782804377160
HO7822083153967100
HO7957254612507100
FG6122242894127000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00994.1Aquca_006_00354.1Aquca_013_00482.2Aquca_013_00482.1Aquca_006_00354.3
Aquca_006_00354.2Aquca_005_00362.2Aquca_005_00362.1Aquca_015_00356.1Aquca_002_00928.1
Aquca_008_00014.2Aquca_008_00014.1Aquca_015_00356.2Aquca_002_00774.1Aquca_005_00444.1
Aquca_017_00613.2Aquca_017_00613.1Aquca_013_00482.3
Arabidopsis lyrata497166477468486584912279478777
312807322297480918477431326001
495550470701902046907363
Arabidopsis thalianaAT3G25140.1AT3G02350.1AT3G61130.1AT4G38270.2AT4G38270.1
AT5G47780.1AT1G18580.1AT2G46480.1AT2G20810.1AT3G01040.2
AT3G01040.1AT5G15470.1AT5G54690.1AT1G06780.2AT1G06780.1
AT2G30575.1AT3G58790.1
Brachypodium distachyonBradi3g43810.1Bradi1g12180.1Bradi4g36050.1Bradi3g20550.2Bradi3g20550.1
Bradi4g33280.1Bradi3g39270.1Bradi5g23250.1Bradi1g45210.1Bradi1g60010.1
Bradi4g03670.1Bradi4g14910.1Bradi1g70290.1Bradi1g70290.2Bradi2g48710.1
Bradi3g59370.1
Brassica rapaBra015104Bra013229Bra021466Bra001040Bra007573
Bra033560Bra014349Bra024910Bra014453Bra004535
Bra025667Bra016552Bra015239Bra006301Bra039149
Bra022739Bra002963Bra015529Bra031537Bra001025
Bra023519Bra008696Bra007420Bra003357Bra029010
Bra021650
Carica papayaevm.model.supercontig_43.115evm.model.supercontig_70.2evm.model.supercontig_20.219evm.model.supercontig_27.191evm.model.supercontig_18.164
evm.model.supercontig_3.244evm.model.supercontig_9.231evm.model.supercontig_97.76evm.model.supercontig_52.137evm.model.supercontig_50.74
evm.model.supercontig_14.153
Capsella rubellaCarubv10013367mCarubv10013365mCarubv10016785mCarubv10006353mCarubv10026096m
Carubv10025515mCarubv10008800mCarubv10013424mCarubv10016906mCarubv10016905m
Carubv10013435mCarubv10027804mCarubv10000686mCarubv10008650mCarubv10025075m
Carubv10016997m
Citrus clementinaCiclev10011396mCiclev10027946mCiclev10019146mCiclev10014562mCiclev10019659m
Ciclev10014426mCiclev10020276mCiclev10014869mCiclev10011444mCiclev10019396m
Ciclev10008578mCiclev10007975mCiclev10008973mCiclev10008241mCiclev10031800m
Ciclev10031200mCiclev10032150mCiclev10032135m
Citrus sinensisorange1.1g008561morange1.1g011612morange1.1g040435morange1.1g005684morange1.1g005683m
orange1.1g007832morange1.1g006413morange1.1g006215morange1.1g011023morange1.1g009436m
orange1.1g005035morange1.1g009572morange1.1g008157morange1.1g007412morange1.1g015279m
orange1.1g009348morange1.1g011913morange1.1g007588morange1.1g011974morange1.1g007529m
orange1.1g012480morange1.1g010187morange1.1g009468morange1.1g012380morange1.1g008524m
Cucumis sativusCucsa.078020.1Cucsa.362990.3Cucsa.362990.2Cucsa.362990.1Cucsa.099660.1
Cucsa.044420.2Cucsa.044420.1Cucsa.180730.1Cucsa.257890.1Cucsa.007320.1
Cucsa.198610.1Cucsa.300840.1Cucsa.174740.1Cucsa.157950.3Cucsa.157950.2
Cucsa.157950.1Cucsa.059680.1Cucsa.388660.2Cucsa.388660.1Cucsa.139610.2
Cucsa.139610.1
Eucalyptus grandisEucgr.K02133.1Eucgr.I02091.1Eucgr.E01335.2Eucgr.E01335.1Eucgr.D00963.4
Eucgr.D00963.3Eucgr.D00963.2Eucgr.D00963.1Eucgr.B00636.1Eucgr.J01378.1
Eucgr.B01494.1Eucgr.I01979.1Eucgr.F00995.2Eucgr.F00995.1Eucgr.A01962.1
Fragaria vescamrna17381.1-v1.0-hybridmrna19436.1-v1.0-hybridmrna04185.1-v1.0-hybridmrna19862.1-v1.0-hybridmrna17317.1-v1.0-hybrid
mrna10269.1-v1.0-hybridmrna26124.1-v1.0-hybridmrna04333.1-v1.0-hybridmrna08199.1-v1.0-hybridmrna03305.1-v1.0-hybrid
mrna24493.1-v1.0-hybrid
Glycine maxGlyma18g33210.1Glyma08g46210.1Glyma13g06990.1Glyma19g05060.1Glyma07g08910.2
Glyma03g02250.2Glyma18g45750.2Glyma09g40260.1Glyma05g09200.2Glyma08g46210.2
Glyma17g00782.2Glyma17g00782.1Glyma07g40011.1Glyma09g01980.1Glyma15g12900.1
Glyma05g07410.2Glyma05g07410.1Glyma17g08910.1Glyma13g37650.1Glyma12g32820.1
Glyma06g22730.1Glyma04g31770.1Glyma08g26480.1Glyma18g49960.1Glyma12g34280.1
Glyma12g16550.1Glyma13g36280.1Glyma03g31590.2Glyma03g31590.1Glyma19g34420.3
Glyma19g34420.2Glyma19g34420.1Glyma02g15990.1Glyma10g03770.3Glyma10g03770.2
Glyma10g03770.1Glyma06g41630.1Glyma13g05950.4Glyma13g05950.3Glyma13g05950.2
Glyma13g05950.1Glyma19g03460.4Glyma19g03460.3Glyma19g03460.2Glyma19g03460.1
Glyma08g42280.1Glyma18g12604.1Glyma14g03110.1Glyma02g45720.2Glyma08g42280.3
Glyma08g42280.2
Gossypium raimondiiGorai.001G188500.6Gorai.001G188500.5Gorai.001G188500.4Gorai.001G188500.3Gorai.001G188500.2
Gorai.001G188500.1Gorai.001G104800.2Gorai.001G104800.1Gorai.008G059800.3Gorai.008G059800.2
Gorai.008G059800.1Gorai.001G205700.2Gorai.001G205700.1Gorai.001G104800.3Gorai.001G188500.7
Gorai.013G063700.3Gorai.013G063700.2Gorai.013G063700.1Gorai.001G172800.1Gorai.004G155600.3
Gorai.004G155600.2Gorai.004G155600.1Gorai.007G093500.1Gorai.002G013600.1Gorai.010G190800.5
Gorai.010G190800.3Gorai.010G190800.2Gorai.010G190800.1Gorai.012G131400.1Gorai.007G040000.1
Gorai.012G049900.4Gorai.012G049900.2Gorai.012G049900.1Gorai.010G190800.4Gorai.009G185300.1
Gorai.002G082100.1Gorai.007G081500.4Gorai.007G081500.2Gorai.007G081500.1Gorai.013G164000.1
Gorai.001G243400.1Gorai.004G219100.1Gorai.007G142400.1Gorai.004G074600.1Gorai.012G049900.3
Gorai.007G081500.5Gorai.007G081500.3Gorai.002G082100.2Gorai.013G164000.2Gorai.012G042500.9
Gorai.012G042500.8Gorai.012G042500.7Gorai.012G042500.6Gorai.012G042500.5Gorai.012G042500.3
Gorai.012G042500.2Gorai.012G042500.10Gorai.012G042500.1Gorai.012G042500.4
Linum usitatissimumLus10011834Lus10022766Lus10003045Lus10009311Lus10036540
Lus10041389Lus10026546Lus10013832Lus10038739Lus10018554
Lus10013506Lus10007979Lus10039119Lus10032990Lus10015379
Lus10014750Lus10033861Lus10024859Lus10018773Lus10013189
Lus10030703Lus10035836Lus10036619
Malus domesticaMDP0000120543MDP0000132973MDP0000922600MDP0000290004MDP0000261777
MDP0000124691MDP0000210431MDP0000854555MDP0000594960MDP0000243946
MDP0000467359MDP0000256818MDP0000303446MDP0000252906MDP0000160619
MDP0000513437MDP0000243968MDP0000271287MDP0000310017MDP0000609623
MDP0000312108MDP0000238731MDP0000195879MDP0000281970MDP0000168165
MDP0000157869MDP0000152152MDP0000685698MDP0000179747
Manihot esculentacassava4.1_004725mcassava4.1_023788mcassava4.1_004712mcassava4.1_023909mcassava4.1_003142m
cassava4.1_002901mcassava4.1_002719mcassava4.1_003238mcassava4.1_003647mcassava4.1_005298m
cassava4.1_005277mcassava4.1_032323mcassava4.1_005259mcassava4.1_005287mcassava4.1_005224m
cassava4.1_004101mcassava4.1_009287mcassava4.1_007284mcassava4.1_032123m
Medicago truncatulaMedtr7g055600.1AC146721_1014.1Medtr2g027740.1Medtr3g107930.1Medtr7g075840.1
Medtr8g092000.2Medtr8g092000.1Medtr2g015550.1Medtr2g006790.1Medtr2g006760.1
Medtr2g082650.2Medtr2g082650.1Medtr6g013840.1Medtr4g133570.1Medtr7g012370.1
Mimulus guttatusmgv1a003761mmgv1a003891mmgv1a002354mmgv1a002760mmgv1a004359m
mgv1a002625mmgv1a004293mmgv1a004534mmgv1a004325mmgv1a004326m
mgv1a003230mmgv1a004225mmgv1a004198mmgv1a004260m
Oryza sativaLOC_Os02g29530.1LOC_Os09g36190.2LOC_Os09g36190.1LOC_Os06g49810.1LOC_Os09g36180.1
LOC_Os10g21890.2LOC_Os10g21890.1LOC_Os06g51160.1LOC_Os09g30280.1LOC_Os08g38740.1
LOC_Os08g23780.1LOC_Os04g54360.1LOC_Os03g30000.1LOC_Os06g12280.1LOC_Os02g51130.1
LOC_Os12g38930.1LOC_Os11g37980.1LOC_Os03g11330.1LOC_Os01g52710.1
Panicum virgatumPavirv00061950mPavirv00060594mPavirv00041812mPavirv00014771mPavirv00014770m
Pavirv00014769mPavirv00053585mPavirv00009328mPavirv00008912mPavirv00039944m
Pavirv00062614mPavirv00050016mPavirv00032585mPavirv00035093mPavirv00043038m
Pavirv00067407mPavirv00055112mPavirv00015507mPavirv00065232mPavirv00066980m
Pavirv00009329mPavirv00035094mPavirv00003326mPavirv00041981mPavirv00015393m
Pavirv00007172mPavirv00031307mPavirv00065296mPavirv00016072mPavirv00033462m
Pavirv00014352mPavirv00030037mPavirv00030036mPavirv00059245mPavirv00020743m
Pavirv00020990mPavirv00031794mPavirv00031793mPavirv00024701m
Physcomitrella patensPp1s251_8V6.1Pp1s128_25V6.1Pp1s21_294V6.1Pp1s507_8V6.4Pp1s507_8V6.3
Pp1s507_8V6.2Pp1s507_8V6.1Pp1s53_223V6.1Pp1s72_167V6.1Pp1s10_95V6.1
Pp1s16_361V6.1Pp1s18_97V6.1
Phaseolus vulgarisPhvul.008G283600.1Phvul.008G132200.1Phvul.004G045900.1Phvul.008G074000.1Phvul.010G087600.1
Phvul.009G115700.1Phvul.003G088900.2Phvul.003G088900.1Phvul.006G135100.1Phvul.009G203500.1
Phvul.003G182500.1Phvul.011G111900.1Phvul.005G107500.1Phvul.008G035400.1Phvul.005G091200.1
Phvul.001G157200.4Phvul.001G157200.3Phvul.001G157200.2Phvul.001G157200.1Phvul.007G177400.1
Phvul.004G034200.2Phvul.004G034200.1Phvul.011G141200.1Phvul.006G034100.1Phvul.008G190700.1
Phvul.008G190700.2
Picea abiesMA_9720735g0010MA_12186g0010MA_10431360g0010MA_130739g0010MA_110784g0010
MA_938560g0010MA_5732482g0010MA_118674g0010MA_10399g0020MA_10508g0010
MA_14268g0010MA_7999321g0010
Populus trichocarpaPotri.002G246500.1Potri.017G106800.3Potri.017G106800.2Potri.017G106800.1Potri.004G111000.2
Potri.004G111000.1Potri.008G010000.1Potri.002G151400.2Potri.002G151400.1Potri.014G073800.5
Potri.014G073800.4Potri.014G073800.3Potri.014G073800.2Potri.014G073800.1Potri.004G206000.3
Potri.004G206000.2Potri.004G206000.1Potri.016G001700.3Potri.016G001700.2Potri.006G001100.2
Potri.006G001100.1Potri.016G001700.1Potri.015G060800.3Potri.015G060800.2Potri.015G060800.1
Potri.013G146200.1Potri.019G108900.1Potri.019G105100.1Potri.012G064500.1Potri.017G090800.1
Potri.004G124500.2Potri.004G124500.1Potri.011G132600.1Potri.001G416800.1Potri.005G218900.2
Potri.005G218900.1Potri.014G142000.2Potri.014G142000.1
Prunus persicappa003603mppa002418mppa018681mppa003250mppa005253m
ppa004031mppa004063mppa004043mppa002758mppa023862m
ppa004045mppa005810m
Ricinus communis30217.m00025129832.m00031230174.m00893230053.m00010329805.m001535
30138.m00393529983.m00326329630.m00078729883.m00200228166.m001056
29993.m001048
Setaria italicaSi016867mSi029123mSi034827mSi029152mSi013390m
Si015690mSi009599mSi009596mSi009595mSi035034m
Si006285mSi020048mSi026393mSi034955mSi021715m
Si001402m
Selaginella moellendorffii111745141437230273146475440751
268781
Sorghum bicolorSb04g020140.1Sb02g030820.1Sb01g011560.1Sb10g030870.1Sb02g027840.1
Sb07g014890.1Sb06g029980.1Sb01g032570.1Sb10g008060.1Sb04g028010.1
Sb04g036420.1Sb05g022970.1Sb08g019260.1Sb03g033400.1
Thellungiella halophilaThhalv10002465mThhalv10020416mThhalv10005820mThhalv10024734mThhalv10000819m
Thhalv10007318mThhalv10001954mThhalv10020487mThhalv10013218mThhalv10013202m
Thhalv10007109mThhalv10016398mThhalv10005879m
Vitis viniferaGSVIVT01003922001GSVIVT01036507001GSVIVT01027574001GSVIVT01023883001GSVIVT01006978001
GSVIVT01030583001GSVIVT01008143001GSVIVT01011500001GSVIVT01014592001GSVIVT01000744001
GSVIVT01000800001
Zea maysAC177908.3_FGT002AC209664.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)