y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g29850.1
FamilyGH13
Protein PropertiesLength: 830 Molecular Weight: 93819.2 Isoelectric Point: 7.3242
ChromosomeChromosome/Scaffold: 1 Start: 25343555 End: 25349173
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132766014.9e-27
  LPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASSNVTDGLHGYDVGQNTQESYFHTGERGYHK
  LWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYNHHGINMSFAGNYKEYFGLDTDVDAVVYMMLANHLMHKLLPEATVVAEDVSGMPVL
  CRPVDEGGVGFDYRLAMAIPDRWIDYLKNKDDLEWSMSGIALTLTNRRYTEKCIAYAESHDQSIVGDKTMAFLLMDKEMYTGMSDLQPASPTIDRGIALQ
  KMIHFITMALGGDGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 830     Download
MLCLACSRSP LPRPSPTDRP GPGIAGVAGG GNVRLSVVPV PSPPLRCSWP RKAKSKFSVP    60
VAVRENQNMA MKEDGFDNLP IYKLDPKLAE FKVHFDYRIK RYLEQKQSIE QNEGSLAEFS    120
KGYLKFGINT DGDTTVYREW APAAKEAQLV GDFNNWNGAM HKMERDKYGV WSIRISHVNG    180
KPAIPHNSKV KFCFRRGDGV WVDRIPAWIR YATFDASKFG APYDGIHWDP PTSERYVFKH    240
PRPPKPGAPR IYEAHVGMSG EKPEVSTYRE FADNVLPRIR ANNYNTVQLM AIMEHSYYAS    300
FGYHVTNFFA VSSRSGTPED LKYLVDKAHS LGLRVLMDVV HSHASSNVTD GLHGYDVGQN    360
TQESYFHTGE RGYHKLWDSR LFNYANWEVL RFLLSNLRYW MDEFMFDGFR FDGVTSMLYN    420
HHGINMSFAG NYKEYFGLDT DVDAVVYMML ANHLMHKLLP EATVVAEDVS GMPVLCRPVD    480
EGGVGFDYRL AMAIPDRWID YLKNKDDLEW SMSGIALTLT NRRYTEKCIA YAESHDQSIV    540
GDKTMAFLLM DKEMYTGMSD LQPASPTIDR GIALQKMIHF ITMALGGDGY LNFMGNEFGH    600
PEWIDFAREG NNWSYDKCRR QWSLVDTDHL RYKYMNAFDQ AMNALDDKFS FLSSSKQIVS    660
DVNEEKKVIV FERGDLVFVF NFHPNKTYEG YKVGCDLPGK YRVALDSDAF LFGGHGRVGH    720
DIDHFTSPEG VPGVAKTNFN NRPNSFKVLS PPRTCVVYKR ADEKAEVHKM EGAAASGKIA    780
LDYIGVDATY IKQIADKEAA SGSRKASTED DSGKKGTKFA LQSSVEDKK*               840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029604.0e-69817584+
PLN03244PLN032442.0e-140182759580+
PLN02447PLN02447048788741+
cd11321AmyAc_bac_euk_BE0232640409+
PLN02960PLN029600182761581+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD30187.1018291829starch branching enzyme I [Aegilops tauschii subsp. strangulata]
GenBankAAG27621.1018291830AF286317_1 starch branching enyzyme 1 [Triticum aestivum]
GenBankAAG27622.1018291833AF286318_1 starch branching enyzyme 1 [Triticum aestivum]
EMBLCAB40979.1018291833starch branching enzyme I [Triticum aestivum]
EMBLCAB40980.1018291865starch branching enzyme I [Triticum aestivum]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A0778299755A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3amk_A0777669698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0777669698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0777669698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D3.99931e-4213171422577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO6191676141657770
HO794536709817750
CX1091874533788300
HO7776386541367750
HO77763844841275
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi5g09170.2Bradi5g09170.1
Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)