y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g34550.1
FamilyGT64
Protein PropertiesLength: 387 Molecular Weight: 42754.1 Isoelectric Point: 10.5686
ChromosomeChromosome/Scaffold: 1 Start: 30143717 End: 30146325
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT641333780
  YVVVVNTWKRYGLLRRAVAHYSGCAGVDAVHVVWSEPREPPEALRRSVLNCSSAAEVRFEVNREDSLNNRFRPIQGLRTDAVFSVDDDLIVPCATLRFAF
  SVWRSAPSAMVGFVPRMHWLADPRSNTEEFRYASWWSVWRTGTYSMILSKASFFHKKYLDLYTNHMLPSIRDYVTENRNCEDIAISFLVANVTGAPPIWV
  QGRIYEIGSSGISSLKGHDLQRSRCLNKFAAMYGHMPLVATTAKAV
Full Sequence
Protein Sequence     Length: 387     Download
MYNSMYSVVR TIHNHHHLSS IWKGKQLGVL LRLSSTGTGA RANQSSLSAP MLLGVAKLQL    60
QATAAAAFRR NGTRRRPLLV PVPARHPSGA SAGRFAACFV ACLLALAAAT VLALTLRRLD    120
PDAASPRGGG GGYVVVVNTW KRYGLLRRAV AHYSGCAGVD AVHVVWSEPR EPPEALRRSV    180
LNCSSAAEVR FEVNREDSLN NRFRPIQGLR TDAVFSVDDD LIVPCATLRF AFSVWRSAPS    240
AMVGFVPRMH WLADPRSNTE EFRYASWWSV WRTGTYSMIL SKASFFHKKY LDLYTNHMLP    300
SIRDYVTENR NCEDIAISFL VANVTGAPPI WVQGRIYEIG SSGISSLKGH DLQRSRCLNK    360
FAAMYGHMPL VATTAKAVDS RTSWFW*                                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09258Glyco_transf_648.0e-100139378244+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD53800.108238628355putative Reg receptor [Oryza sativa Japonica Group]
DDBJBAH01223.108238629343unnamed protein product [Oryza sativa Japonica Group]
GenBankEAZ02288.108238627351hypothetical protein OsI_24388 [Oryza sativa Indica Group]
RefSeqXP_002267908.109738642338PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002437555.1012038685355hypothetical protein SORBIDRAFT_10g029290 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B2e-3311437013272A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1on8_A2e-3311437013272A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1on6_B2e-3311437013272A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1on6_A2e-3311437013272A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1omz_B2e-3311437013272A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
Transmembrane Domains
StartEnd
95117
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CR2876031991893870
EX3684962581383870
EX3552742581383870
CN5247142571383870
CO0738212541413870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra009448Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna09156.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_010734mcassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504m
cassava4.1_010773mcassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00020436mPavirv00023272mPavirv00018756mPavirv00050841m
Pavirv00045066mPavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.008G225700.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)