y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g34707.1
FamilyCE10
Protein PropertiesLength: 468 Molecular Weight: 51715.7 Isoelectric Point: 8.5233
ChromosomeChromosome/Scaffold: 1 Start: 30312782 End: 30317399
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101674320
  QVHRSVVYGEQPRNRLDLYIPTGTTESKPVVAFITGGAWIIGYKGWGALLGRRLAERGILVACIDYRNFPQGTIGDMVEDASQGISFICNNIASYGGDPE
  RIYLVGQSAGAHIAACTLLNQAIKECGEGDTSTWSIAQLKAYFGISGGYNLLNLVDHFHRRGLYRSIFLSIMEGEESLKKFSPQVMVKESASRSALPLLP
  HIFLFHGTSDCSIPCAESQAFLDALQQHGAKADLFLYEGKTHTDLFLQDPLRGGRDKMLEEIVAAI
Full Sequence
Protein Sequence     Length: 468     Download
MEVELPARAA SQPGKARETP PPSPVAAVAS LAEDAPLLPG GAGAGVRRRP VSEQFRQRSA    60
SLRRDVGRAA AETFLLSRLA LILLRYLGYP PIPFSLLLAL RSALLLTVGA IEYVNRMEWF    120
RSDPWVKSDR FRIGYRWIRQ FLALCCYALL LMPGFIQVLY YYFFSNQVHR SVVYGEQPRN    180
RLDLYIPTGT TESKPVVAFI TGGAWIIGYK GWGALLGRRL AERGILVACI DYRNFPQGTI    240
GDMVEDASQG ISFICNNIAS YGGDPERIYL VGQSAGAHIA ACTLLNQAIK ECGEGDTSTW    300
SIAQLKAYFG ISGGYNLLNL VDHFHRRGLY RSIFLSIMEG EESLKKFSPQ VMVKESASRS    360
ALPLLPHIFL FHGTSDCSIP CAESQAFLDA LQQHGAKADL FLYEGKTHTD LFLQDPLRGG    420
RDKMLEEIVA AIHNDDPGES AQHLPVPVAR RLVPEIMLIL ARRVSPF*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07859Abhydrolase_33.0e-919928588+
cd00312Esterase_lipase5.0e-10182290123+
COG2272PnbA4.0e-10182285118+
pfam00135COesterase3.0e-10182285116+
COG0657Aes7.0e-26172432269+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG46361.1014671418carboxylesterase-like protein [Zea mays]
GenBankEAZ02309.1014671425hypothetical protein OsI_24410 [Oryza sativa Indica Group]
RefSeqNP_001058531.1014671425Os06g0708100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132117.10294673404hypothetical protein LOC100193534 [Zea mays]
RefSeqXP_002264962.105846752417PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2hm7_A0.00000000318128361164A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1u4n_A0.00000000418128361164A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1qz3_A0.00000000418128361164A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate
PDB1evq_A0.00000000418128361164A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1f6w_A0.0000000416828469205A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
Transmembrane Domains
StartEnd
89111
141163
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6038312632064680
GO8961552542154680
GO7985762542154680
FF5953332431433850
GE4792562991354320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)