y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g35220.1
FamilyGH9
Protein PropertiesLength: 517 Molecular Weight: 55879.6 Isoelectric Point: 4.7847
ChromosomeChromosome/Scaffold: 1 Start: 30718366 End: 30720800
Descriptionglycosyl hydrolase 9B5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9445020
  KYAEALAVALQFFQVQKSGKLVKNEIPWRGDSAVDDGQEAGLDLSKGMYDAGDHIKFGFPMAFTATMLSWSVLEYGGAMRAARQRDSALDALRWIMDYLL
  NAHPSDDELYIQVGDPEADHKCWERPETMSEKRPLTKITAKSPGSDVAAETAAAMAAASLVYKPIDGTYSSSLLRHAEQLFAFADRHRGSYTHTFPKLSA
  YYNSTTYQDELLWAAGWLFHATGNGSYLSYATGENGQEFADLGNPRYFSWDDKRPGTQVLLSRVSFFASQGSGIEQDSLDGVESYKQTADAVMCILLPDS
  ETAAPRTEGGLLYVADWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGSQTFSPADLRKFAKSQADYVLGENPMKVSYLVGYGDSYPQQVHHRGASIPAD
  VDTGCGGQEWLESPEPNPNVATGALVGGPFRNDSFVDKRDNVMQNEATTYNSALIVGLL
Full Sequence
Protein Sequence     Length: 517     Download
MAQSVRCCCW LLVLTLVALG ITAAVVFVRH KNGGGGVPGS VDPKYAEALA VALQFFQVQK    60
SGKLVKNEIP WRGDSAVDDG QEAGLDLSKG MYDAGDHIKF GFPMAFTATM LSWSVLEYGG    120
AMRAARQRDS ALDALRWIMD YLLNAHPSDD ELYIQVGDPE ADHKCWERPE TMSEKRPLTK    180
ITAKSPGSDV AAETAAAMAA ASLVYKPIDG TYSSSLLRHA EQLFAFADRH RGSYTHTFPK    240
LSAYYNSTTY QDELLWAAGW LFHATGNGSY LSYATGENGQ EFADLGNPRY FSWDDKRPGT    300
QVLLSRVSFF ASQGSGIEQD SLDGVESYKQ TADAVMCILL PDSETAAPRT EGGLLYVADW    360
NSLQHPVASA FLAAVYSDYM LTSGKTELSC GSQTFSPADL RKFAKSQADY VLGENPMKVS    420
YLVGYGDSYP QQVHHRGASI PADVDTGCGG QEWLESPEPN PNVATGALVG GPFRNDSFVD    480
KRDNVMQNEA TTYNSALIVG LLSGILSTSP VAQSLS*                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021711.0e-14614503499+
PLN02340PLN023409.0e-14745514479+
PLN00119PLN001195.0e-14939505475+
pfam00759Glyco_hydro_91.0e-16745503463+
PLN02345PLN02345048516471+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ02358.1015161518hypothetical protein OsI_24462 [Oryza sativa Indica Group]
GenBankEAZ38281.1015161494hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
GenBankEEC84946.103651649528hypothetical protein OsI_32163 [Oryza sativa Indica Group]
RefSeqNP_001058583.1015161518Os06g0715300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002439027.1065164522hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0455015425A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis
PDB1ksc_A0455015425A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis
PDB1ks8_A0455015425A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0445015437A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0445015437A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH1885863881315170
HO7820383182025170
GR2182833331795090
GR2182823271795030
ES8173623251114340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Cucumis sativusCucsa.342940.1
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma02g05510.1Glyma04g02740.1Glyma06g02760.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.007G195700.1Gorai.010G005200.1Gorai.009G195400.2
Gorai.009G195400.3Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10034515Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny