y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g36027.1
FamilyGH127
Protein PropertiesLength: 875 Molecular Weight: 94713.3 Isoelectric Point: 6.8503
ChromosomeChromosome/Scaffold: 1 Start: 31625558 End: 31630351
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273766491.9e-23
  DPLYKEISTFFMDIVNTSHSYATGGTSVSEFWSDPKRLASTLTTENEESCTTYNMLKVSRHLFRWTKEIAYADYYERALINGVLSIQRGRDPGVMIYMLP
  QGPGRSKAVSYHGWGTQYDSFWCCYGTGIESFSKLGDTIYFEEKGSKPTLYVVQYIPSIFNWKSAGLTVTQRLKPLSSSDQYLQVSLSISAKTNGQYATV
  NVRIPSWASANGAKATLNDKYLQLGSPGTFLTVTKQWNSGDHLTLQLPINLRTEAIKDDRAEFASLQAVLFGPF
Full Sequence
Protein Sequence     Length: 875     Download
MARRGLPLPA PLVMPALSLA LALAMAVAKE CTNVPTQLSS HTVRARLQGD PSAEEWRLRA    60
LFHDHAHVSP TDEATWMDLR APLASSAATE ESGWAMLYRA LKGSASGGSA SAAAGFLEEV    120
PLQDVRLDME EDAVYGRAQQ TNLEYLLLLD VDRLLWSFRT QAGLPAPGKP YGGWEGADVE    180
LRGHFVGHYL SAAAKTWAST HNGTLAAKMS AVVDALHECQ QAAAANGGNG YLSAFPAEFF    240
DRFEAIQPVW APYYTVHKIM QGLLDQHTVA GNGKALAMAV AMAGYFGGRV RSVIQRHGIE    300
RHWTSLNEET GGMNDVLYQL YTITNDQRHL VLAHLFDKPC FLGLLAVQAD SLTGFHANTH    360
IPVVVGGQMR YEVTGDPLYK EISTFFMDIV NTSHSYATGG TSVSEFWSDP KRLASTLTTE    420
NEESCTTYNM LKVSRHLFRW TKEIAYADYY ERALINGVLS IQRGRDPGVM IYMLPQGPGR    480
SKAVSYHGWG TQYDSFWCCY GTGIESFSKL GDTIYFEEKG SKPTLYVVQY IPSIFNWKSA    540
GLTVTQRLKP LSSSDQYLQV SLSISAKTNG QYATVNVRIP SWASANGAKA TLNDKYLQLG    600
SPGTFLTVTK QWNSGDHLTL QLPINLRTEA IKDDRAEFAS LQAVLFGPFL LAGLSTGDWD    660
AKTGAAAAAI SDWISPVPSS YSSQLVTLTQ ESGGSTFVLS TVNGTSLAMQ PRPEGGGTEA    720
AVHGTFRLVP QGFSPPPTTN RRHGAPTNLA SAMIEPFDLP GMAITDALTV VRSEEKSSGS    780
LLFNVVPGLD GKPGSVSLEL GTRPGCFVVT AGAKVQVGCG AGFSQAAASF ARAEPLRRYH    840
PISFVARGAR RGFLLEPLFT LRDEFYTVYF NLGA*                               900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35338.0e-62162653500+
pfam07944DUF16801.0e-145124652540+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD35522.102987423883hypothetical protein [Oryza sativa Japonica Group]
GenBankEAY84862.102987426891hypothetical protein OsI_06226 [Oryza sativa Indica Group]
GenBankEEC80970.102987423905hypothetical protein OsI_23693 [Oryza sativa Indica Group]
RefSeqNP_001058067.102987423924Os06g0612900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002438671.102987429887hypothetical protein SORBIDRAFT_10g024070 [Sorghum bicolor]
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8434393513236730
EC8907112872645500
DV1647312803756530
DV0260092621564170
GT8197672492885360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1
Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny