y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g37160.1
FamilyCBM43
Protein PropertiesLength: 485 Molecular Weight: 52656.4 Isoelectric Point: 5.2812
ChromosomeChromosome/Scaffold: 1 Start: 32941665 End: 32943193
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433684481.3e-22
  WCVLDDEAKAQDKLPGNIQYACAGGDCTALGYGCSCDGLDEKSNISYAFNMYFQMQDQDVRACDFDGLANITDKNASTKGC
GH17303450
  VGVNWGSQLTHPLLPSSVVKMLKDNGIMKVKLFDADPWPVEALLDSGIEVMLGIPNDMLEIMSSYGSAQDWVKENVTAYGDKLKLKYVAVGNEPFLKSYN
  GTFMKTTVPALKNIQKALDAAGLGDKVKATVPLNADVYVSPDDKPSSGQFRPDIDDVMTDMVKFLHDHGAPFVVNIYPFLSLYQSDDFPFEFAFFDGGRN
  IQDKDGVSYSNVFDANYDTLVSALKKAGVGGLKVVVGEVGWPTDGNKNANMKLARRFYDGLMKKLAKNEGTHLRPGKLDVYLFGLFDEDLKSIAPGNFER
  HWGILTYDGKPKFPMD
Full Sequence
Protein Sequence     Length: 485     Download
MAPLLRLLAG AAALLVAVSH ASAWSSAVDV GVNWGSQLTH PLLPSSVVKM LKDNGIMKVK    60
LFDADPWPVE ALLDSGIEVM LGIPNDMLEI MSSYGSAQDW VKENVTAYGD KLKLKYVAVG    120
NEPFLKSYNG TFMKTTVPAL KNIQKALDAA GLGDKVKATV PLNADVYVSP DDKPSSGQFR    180
PDIDDVMTDM VKFLHDHGAP FVVNIYPFLS LYQSDDFPFE FAFFDGGRNI QDKDGVSYSN    240
VFDANYDTLV SALKKAGVGG LKVVVGEVGW PTDGNKNANM KLARRFYDGL MKKLAKNEGT    300
HLRPGKLDVY LFGLFDEDLK SIAPGNFERH WGILTYDGKP KFPMDLSGQG HDKLLAGVSG    360
VQYLPHQWCV LDDEAKAQDK LPGNIQYACA GGDCTALGYG CSCDGLDEKS NISYAFNMYF    420
QMQDQDVRAC DFDGLANITD KNASTKGCLF PVQIISAGGR MAPALRWTTL LALVAHVLVM    480
GFIV*                                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X84.0e-1536743677+
smart00768X84.0e-2736745086+
pfam00332Glyco_hydro_175.0e-6231345318+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR38156.102845636465unknown [Zea mays]
GenBankEAZ37505.102645329456hypothetical protein OsJ_21839 [Oryza sativa Japonica Group]
RefSeqNP_001057968.102645329456Os06g0590600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002275701.1044611461PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438620.102546036472hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B0303473315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ur8_A0303473315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ur7_B0303473315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A0303473315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3f55_D0293471316A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797198428314540
DR818663220312490
FL807090203422440
CF4897512281713980
FL807090452763190.11
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00610.1.369.451Aquca_007_00315.1.404.484Aquca_003_00745.1.367.446Aquca_004_00628.1.371.452Aquca_018_00224.2.330.411
Aquca_018_00224.1.360.441Aquca_004_00435.1.371.450Aquca_114_00021.1.377.459Aquca_009_00540.1.366.447Aquca_004_00629.1.368.448
Arabidopsis lyrata913356.365.447479948.337.417329810.360.439495914.362.443340560.374.456
862228.371.456893776.366.447910127.375.455496695.369.449919046.365.444
Arabidopsis thalianaAT4G31140.1.365.447AT3G24330.1.382.462AT4G17180.1.359.438AT5G58090.1.362.443AT3G04010.1.374.456
AT5G18220.1.369.454AT5G20870.1.375.457AT1G64760.2.366.447AT1G64760.1.366.447AT2G19440.1.362.443
AT5G64790.1.369.449AT5G58480.1.363.442
Brachypodium distachyonBradi3g18220.1.368.449Bradi1g56270.1.376.457Bradi1g13232.1.375.458Bradi4g15460.1.372.456Bradi2g18420.1.369.448
Bradi3g03520.1.370.451Bradi1g06050.1.372.453Bradi1g60410.1.366.447Bradi1g37160.1.368.448Bradi2g18700.1.373.454
Bradi1g65197.1.373.452
Brassica rapaBra011249.365.447Bra020389.362.443Bra002673.364.445Bra015034.380.460Bra026232.357.436
Bra024022.366.449Bra036718.366.446Bra031954.374.455Bra002143.373.458Bra006581.376.461
Bra020132.372.452Bra002646.368.447Bra037795.369.449Bra031901.369.449
Carica papayaevm.model.supercontig_23.144.370.451evm.model.supercontig_148.14.365.446evm.model.supercontig_82.42.362.443evm.model.supercontig_91.73.360.441evm.model.supercontig_51.93.361.442
evm.model.supercontig_2.377
Capsella rubellaCarubv10004695m.365.447Carubv10015679m.380.460Carubv10026324m.362.443Carubv10006187m.360.439Carubv10013602m.362.443
Carubv10013538m.374.456Carubv10003257m.369.454Carubv10000767m.376.458Carubv10028073m.344.423Carubv10027803m.369.449
Citrus clementinaCiclev10008695m.255.336Ciclev10007363m.849.930Ciclev10008079m.383.464Ciclev10014935m.405.484Ciclev10019922m.366.447
Ciclev10008127m.364.445Ciclev10023781m.368.449Ciclev10027796m.368.447
Citrus sinensisorange1.1g011636m.365.446orange1.1g047337m.373.454orange1.1g010142m.405.484orange1.1g010789m.383.464orange1.1g011532m.366.447
orange1.1g011391m.364.445orange1.1g048257m.368.449orange1.1g011468m.368.447orange1.1g045344m.523.603
Cucumis sativusCucsa.116200.1.345.426Cucsa.356270.2.280.361Cucsa.356270.1.371.452Cucsa.310710.1.368.450Cucsa.319480.1.366.445
Cucsa.012240.1.343.420Cucsa.139490.1.372.451Cucsa.340580.1.367.448Cucsa.101480.1.371.451Cucsa.367020.1.372.452
Eucalyptus grandisEucgr.C04137.1.442.523Eucgr.C02145.1.369.451Eucgr.C02156.3.364.445Eucgr.C02156.2.364.445Eucgr.C02156.1.364.445
Eucgr.D00955.1.367.446Eucgr.K01479.1.369.450Eucgr.A02084.1.366.447Eucgr.C03182.1.321.402Eucgr.I00311.1.366.446
Eucgr.J01882.1.378.457
Fragaria vescamrna29858.1-v1.0-hybrid.348.429mrna19854.1-v1.0-hybrid.364.443mrna02065.1-v1.0-hybrid.373.454mrna21072.1-v1.0-hybrid.373.454mrna15460.1-v1.0-hybrid.362.444
mrna12970.1-v1.0-hybrid.364.442mrna28204.1-v1.0-hybrid.351.430mrna21133.1-v1.0-hybrid.367.447mrna21134.1-v1.0-hybrid.351.427
Glycine maxGlyma17g12985.1.864.945Glyma04g22190.1.387.468Glyma06g23474.1.367.448Glyma04g07820.2.371.453Glyma06g07890.1.364.446
Glyma07g39950.1.365.444Glyma09g01910.2.366.445Glyma11g29410.1.372.451Glyma14g16830.1.367.449Glyma15g12850.2.374.454
Glyma15g12850.1.369.449Glyma17g29760.1.364.446Glyma16g04680.1.365.446Glyma18g06570.1.370.449Glyma05g31860.1.368.447
Glyma02g07840.1.323.404Glyma06g15240.2.375.455Glyma13g17600.1.366.449Glyma16g26860.1.370.451Glyma17g04900.1.366.450
Gossypium raimondiiGorai.010G094500.1.365.447Gorai.012G043900.1.385.464Gorai.010G068800.1.872.953Gorai.004G097500.1.363.446Gorai.007G287700.1.368.449
Gorai.013G221700.1.362.444Gorai.013G202800.1.369.450Gorai.012G009200.1.367.450Gorai.013G270800.1.366.445Gorai.008G101400.1.363.443
Gorai.011G114400.1.368.449Gorai.011G114500.1.368.448Gorai.011G114600.1.368.448
Linum usitatissimumLus10039095.369.448Lus10017740.396.477Lus10024535.376.457Lus10033082Lus10020261.370.451
Lus10002633.369.450Lus10001183.372.455Lus10043075.372.455Lus10042269.372.451Lus10040579.345.427
Lus10031098.371.452Lus10028104.345.427Lus10026387.328.407Lus10006811.396.476Lus10005788.396.476
Malus domesticaMDP0000139990.368.447MDP0000180536.371.452MDP0000247204.368.447MDP0000303770.326.407MDP0000295938.357.439
MDP0000228162.380.461MDP0000201986.368.445MDP0000785544.367.448MDP0000547069.370.451MDP0000254562.398.477
MDP0000276748.366.445MDP0000195046.369.451MDP0000896503.366.445MDP0000501865.366.445MDP0000716700.366.446
MDP0000893827.364.443MDP0000245023.356.435MDP0000159387.366.445
Manihot esculentacassava4.1_027986m.113.194cassava4.1_006709m.362.443cassava4.1_021211m.252.333cassava4.1_006647m.365.444cassava4.1_006673m.365.444
cassava4.1_006689m.367.448cassava4.1_006628m.363.444cassava4.1_006682m.365.444cassava4.1_006416m.365.446cassava4.1_006515m.368.447
cassava4.1_027475m.373.453
Medicago truncatulaMedtr3g108600.1.351.433Medtr3g031770.1.364.443Medtr2g027560.1.369.448AC233669_25.1.372.454Medtr6g032820.1.363.443
Medtr7g085390.1.368.449Medtr4g124440.1.366.449Medtr3g095050.1.373.453Medtr8g092070.1.375.455
Mimulus guttatusmgv1a006384m.342.426mgv1a004426m.410.491mgv1a004416m.411.492mgv1a005873m.345.427mgv1a005395m.368.447
mgv1a018565m.297.378mgv1a027166m.364.447mgv1a022774m.363.442mgv1a005260m.367.447mgv1a006359m.323.405
mgv1a024405m.348.428mgv1a025912m.362.442mgv1a005370m.353.435mgv1a006003m.348.428
Oryza sativaLOC_Os08g23720.1.376.455LOC_Os11g36940.1.372.456LOC_Os09g09980.1.365.444LOC_Os08g12800.1.373.454LOC_Os03g45390.1.371.454
LOC_Os03g18520.1.375.454LOC_Os02g04670.1.369.450LOC_Os03g57880.3.377.458LOC_Os03g57880.2.377.458LOC_Os03g57880.1.377.458
LOC_Os03g27980.1.372.453LOC_Os07g07340.1.365.446LOC_Os06g39060.1.371.451LOC_Os05g45860.1.291.372
Panicum virgatumPavirv00040364m.408.487Pavirv00046668m.357.435Pavirv00039130m.369.450Pavirv00010253m.324.403Pavirv00024615m.367.446
Pavirv00060764m.369.450Pavirv00034646m.293.378Pavirv00002022m.320.399Pavirv00063043m.342.423Pavirv00046422m.374.455
Pavirv00016958m.366.446Pavirv00052629m.368.448Pavirv00000796m.278.359Pavirv00064019m.314.395Pavirv00058995m.373.454
Pavirv00009799m.373.454
Physcomitrella patensPp1s54_130V6.1.380.460Pp1s14_30V6.1.377.457Pp1s197_52V6.1.377.457Pp1s27_327V6.1.372.450Pp1s162_17V6.2.371.449
Pp1s162_17V6.1.371.449Pp1s157_11V6.1.367.444Pp1s109_183V6.1
Phaseolus vulgarisPhvul.003G176600.1.897.978Phvul.009G200400.1.369.456Phvul.009G099800.1.131.213Phvul.001G057100.2.280.362Phvul.001G057100.1.367.449
Phvul.006G135700.1.367.446Phvul.003G088600.1.368.447Phvul.006G072800.1.369.448Phvul.004G079100.1.367.448Phvul.001G109400.1.365.446
Phvul.009G138800.1.377.457Phvul.003G126100.1.366.450Phvul.002G266100.1.402.482
Picea abiesMA_17339g0040.332.415MA_43291g0010.369.450MA_10437110g0020.368.449MA_721956g0010
Populus trichocarpaPotri.018G077000.1.373.454Potri.018G072300.1.373.454Potri.016G002800.3.368.447Potri.016G002800.1.368.447Potri.006G002100.1.368.447
Potri.018G000900.1.382.465Potri.006G216700.1.367.448Potri.018G150400.1.364.445Potri.006G280700.2.342.425Potri.006G280700.1.378.461
Potri.006G080600.2.364.446Potri.006G080600.1.364.446Potri.019G032900.3.266.347Potri.019G032900.2.367.448Potri.019G032900.1.395.476
Potri.013G059700.1.367.448Potri.009G076500.1.365.444Potri.016G002800.2.368.437Potri.007G078900.1.372.452Potri.002G000700.1
Prunus persicappa004814m.368.450ppa004783m.373.452ppa004964m.364.445ppa017632m.369.450ppa004643m.366.444
ppa005641m.338.419ppb004066m.366.445ppa017706m.346.425ppa018453m.367.446
Ricinus communis28226.m000880.369.45129836.m000569.365.44429848.m004686.373.45429739.m003664.380.46129777.m000270.363.445
29950.m001151.367.44827758.m000328.369.44930156.m001714.278.357
Setaria italicaSi013645m.369.450Si026278m.372.457Si017029m.370.451Si035350m.378.459Si029637m.367.446
Si040250m.373.452Si013637m.367.446Si035361m.375.456Si029650m.370.451Si008675m.367.447
Si035326m.375.456Si024796m.377.458
Selaginella moellendorffii171231.381.45832959.349.42889756.387.467231117.357.43886140.369.449
236210.379.458267465.357.437
Sorghum bicolorSb01g012900.1.377.458Sb02g017290.1.368.447Sb04g003170.2.369.450Sb04g003170.1.369.450Sb02g003910.1.373.454
Sb07g006340.1.374.455Sb05g022490.1.392.464Sb01g033200.1.373.454Sb01g005610.1.376.459Sb10g022940.1.380.460
Sb09g026690.1.372.453Sb01g038220.1.372.451
Thellungiella halophilaThhalv10024947m.357.436Thhalv10025047m.365.447Thhalv10013422m.362.443Thhalv10002822m.427.507Thhalv10020592m.374.456
Thhalv10015448m.371.456Thhalv10022665m.366.447Thhalv10013340m.373.454Thhalv10012621m.365.444Thhalv10004092m.369.449
Vitis viniferaGSVIVT01002584001.290.369GSVIVT01015435001.864.944GSVIVT01034245001.364.445GSVIVT01033384001.367.448GSVIVT01014995001.363.444
GSVIVT01030073001.368.447
Zea maysAC217887.3_FGT004.373.454AC159612.1_FGT007.337.418
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)