y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g37620.1
FamilyAA1
Protein PropertiesLength: 581 Molecular Weight: 63051.7 Isoelectric Point: 7.2548
ChromosomeChromosome/Scaffold: 1 Start: 33484288 End: 33489053
DescriptionPlant L-ascorbate oxidase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1242130
  AKARHFKWEVSNMFWSPDCEEKVLIGINGQFPGPTIRAKAGDTIVVELKNALHTEGVVIHWHGIRQIGTPWADGTAAISQCAINPEEHFTYRFVVDKPGT
  YFYHGHYGMQRAAGLYGSLIVDVADGEEEPFKYDGELNLLLSDWYHESIYNQMVGLSSKPMRWIGEPQSLLINGRGQFNCSLAAAHTQGA
AA13005520
  WISIGVRGRNPKTAPALALLNYRPNNRAMKLPAVAPPATPAWNDYAHSKAFTQRILARAGTPPPPATSDRRIELLNTQNKMDGGIKWSINNASMVLPATP
  YLGSLKLLGLKPTLGASARPAESFGRGYDVTRPPANPNTTVGDNVYVLAHNATVDVVLQNANALAHNVSEVHPWHLHGHDFWVLGYGEGAYNGDAADAAR
  LNLRNPPLRNTAVIFPYGWTALRFVADNPGVWAFHCHIEPHLHMGMGVIFAEA
Full Sequence
Protein Sequence     Length: 581     Download
MRLLVFLFAC LLACAALPHC AEAAKARHFK WEVSNMFWSP DCEEKVLIGI NGQFPGPTIR    60
AKAGDTIVVE LKNALHTEGV VIHWHGIRQI GTPWADGTAA ISQCAINPEE HFTYRFVVDK    120
PGTYFYHGHY GMQRAAGLYG SLIVDVADGE EEPFKYDGEL NLLLSDWYHE SIYNQMVGLS    180
SKPMRWIGEP QSLLINGRGQ FNCSLAAAHT QGAKQCTGGG NKHCAPVVFP VLPNKTYRLR    240
VASTTSLASL NLAIGNHKLT VVEADGNYVE PFTVDDMDIY SGDSYSVLLT TDQNPSSNYW    300
ISIGVRGRNP KTAPALALLN YRPNNRAMKL PAVAPPATPA WNDYAHSKAF TQRILARAGT    360
PPPPATSDRR IELLNTQNKM DGGIKWSINN ASMVLPATPY LGSLKLLGLK PTLGASARPA    420
ESFGRGYDVT RPPANPNTTV GDNVYVLAHN ATVDVVLQNA NALAHNVSEV HPWHLHGHDF    480
WVLGYGEGAY NGDAADAARL NLRNPPLRNT AVIFPYGWTA LRFVADNPGV WAFHCHIEPH    540
LHMGMGVIFA EAVERVGEVP KAAISCGATA TALMAGGDHP *                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03389laccase1.0e-9727549549+
TIGR03388ascorbase027569544+
PLN02191PLN02191027574550+
PLN02604PLN02604027569544+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG30138.1015771577L-ascorbate oxidase precursor [Zea mays]
GenBankEAZ01378.1015761576hypothetical protein OsI_23411 [Oryza sativa Indica Group]
RefSeqNP_001057898.1015761576Os06g0567200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001141087.1015771578hypothetical protein LOC100273169 [Zea mays]
RefSeqXP_002437180.1075775576hypothetical protein SORBIDRAFT_10g022430 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0245801552A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB1asq_A0245801552A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB1asp_B0245801552A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB1asp_A0245801552A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB1aso_B0245801552A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC882964265443050
DW481317311273360
GR3483102711594290
HO584787545285500
FC893952281513300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_041_00052.1.82.339Aquca_041_00052.1.82.339Aquca_014_00555.1.62.334Aquca_014_00555.1.62.334Aquca_076_00041.2
Aquca_076_00041.1Aquca_041_00052.1.322.551Aquca_041_00052.1.322.551Aquca_014_00555.1.293.531Aquca_014_00555.1.293.531
Arabidopsis lyrata327935489021.76.330489021.76.330489021.332.543489021.332.543
Arabidopsis thalianaAT4G39830.1AT5G21100.1AT5G21105.3.93.349AT5G21105.3.93.349AT5G21105.1.93.348
AT5G21105.1.93.348AT5G21105.2AT5G21105.1.351.561AT5G21105.1.351.561AT5G21105.3.351.538
AT5G21105.3.351.538
Brachypodium distachyonBradi4g28950.1.82.349Bradi4g28950.1.82.349Bradi4g34690.1.66.371Bradi4g34690.1.66.371Bradi1g37600.1.101.397
Bradi1g37600.1.101.397Bradi1g37620.1.24.213Bradi1g37620.1.24.213Bradi4g28950.1.336.556Bradi4g28950.1.336.556
Bradi1g37620.1.300.552Bradi1g37620.1.300.552Bradi1g37600.1.396.616Bradi1g37600.1.396.616Bradi4g34690.1.374.560
Bradi4g34690.1.374.560
Brassica rapaBra021239Bra002357.76.340Bra002357.76.340Bra020145.76.334Bra020145.76.334
Bra040902.79.327Bra040902.79.327Bra002355.79.329Bra002355.79.329Bra040902.333.545
Bra040902.333.545Bra002357.331.550Bra002357.331.550Bra020145.312.543Bra020145.312.543
Bra002355.333.550Bra002355.333.550Bra002356
Carica papayaevm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.329.574evm.model.supercontig_103.59.329.574
Capsella rubellaCarubv10003529mCarubv10004461mCarubv10000569m.76.336Carubv10000569m.76.336Carubv10000578m.78.329
Carubv10000578m.78.329Carubv10000578m.287.554Carubv10000578m.287.554Carubv10000569m.338.548Carubv10000569m.338.548
Chlamydomonas reinhardtiiCre01.g031500.t1.2Cre02.g098350.t1.3
Citrus clementinaCiclev10014733mCiclev10025235m.97.370Ciclev10025235m.97.370Ciclev10025235m.335.568Ciclev10025235m.335.568
Citrus sinensisorange1.1g008038morange1.1g007890m.97.371orange1.1g007890m.97.371orange1.1g012467morange1.1g013385m
orange1.1g016150morange1.1g016030morange1.1g007890m.335.568orange1.1g007890m.335.568
Cucumis sativusCucsa.142840.1Cucsa.142830.1Cucsa.104600.1.63.324Cucsa.104600.1.63.324Cucsa.142810.1.299.517
Cucsa.142810.1.299.517Cucsa.104600.1.292.531Cucsa.104600.1.292.531
Eucalyptus grandisEucgr.B03781.1Eucgr.J00632.1Eucgr.I00388.1.75.347Eucgr.I00388.1.75.347Eucgr.I00451.1.64.318
Eucgr.I00451.1.64.318Eucgr.I00386.1.71.301Eucgr.I00386.1.71.301Eucgr.G00738.1.40.302Eucgr.G00738.1.40.302
Eucgr.I00360.1Eucgr.G00745.1Eucgr.I00451.1.277.518Eucgr.I00451.1.277.518Eucgr.I00388.1.301.548
Eucgr.I00388.1.301.548Eucgr.I00383.1Eucgr.I00385.1Eucgr.I00386.1.256.483Eucgr.I00386.1.256.483
Eucgr.G00738.1.290.505Eucgr.G00738.1.290.505Eucgr.I00361.1Eucgr.I00361.2
Fragaria vescamrna18497.1-v1.0-hybridmrna31737.1-v1.0-hybridmrna11056.1-v1.0-hybridmrna11055.1-v1.0-hybridmrna00542.1-v1.0-hybrid
Glycine maxGlyma14g04530.1Glyma20g12220.1Glyma13g03650.1Glyma20g12150.1Glyma05g33470.1.88.358
Glyma05g33470.1.88.358Glyma08g14730.1.90.352Glyma08g14730.1.90.352Glyma05g33470.1.354.553Glyma05g33470.1.354.553
Glyma08g14730.1.349.552Glyma08g14730.1.349.552
Gossypium raimondiiGorai.004G227900.1Gorai.008G103600.1Gorai.003G045100.1
Linum usitatissimumLus10009603Lus10016808Lus10000871.59.334Lus10000871.59.334Lus10022504.87.341
Lus10022504.87.341Lus10026753.80.305Lus10026753.80.305Lus10025538Lus10000871.318.529
Lus10000871.318.529Lus10026753.306.552Lus10026753.306.552Lus10022504.343.558Lus10022504.343.558
Malus domesticaMDP0000179298.35.319MDP0000179298.35.319MDP0000131142.89.323MDP0000131142.89.323MDP0000459146.40.262
MDP0000459146.40.262MDP0000125288.36.266MDP0000125288.36.266MDP0000125288.374.614MDP0000125288.374.614
MDP0000179298.298.525MDP0000179298.298.525MDP0000201304MDP0000568244MDP0000131142.325.559
MDP0000131142.325.559MDP0000459146.260.495MDP0000459146.260.495MDP0000920266.221.462MDP0000920266.221.462
Manihot esculentacassava4.1_029114m.82.347cassava4.1_029114m.82.347cassava4.1_003963m.155.371cassava4.1_003963m.155.371cassava4.1_004384m.36.226
cassava4.1_004384m.36.226cassava4.1_004384m.318.564cassava4.1_004384m.318.564cassava4.1_003963m.333.583cassava4.1_003963m.333.583
cassava4.1_029114m.300.548cassava4.1_029114m.300.548
Medicago truncatulaMedtr8g091390.1.86.341Medtr8g091390.1.86.341Medtr8g091390.1.315.552Medtr8g091390.1.315.552
Mimulus guttatusmgv1a003391m.33.225mgv1a003391m.33.225mgv1a003543mmgv1a003391m.335.562mgv1a003391m.335.562
mgv1a005649m.212.451mgv1a005649m.212.451
Oryza sativaLOC_Os06g37080.1LOC_Os09g20090.1.54.408LOC_Os09g20090.1.54.408LOC_Os09g32952.1LOC_Os06g37150.1.86.374
LOC_Os06g37150.1.86.374LOC_Os06g37150.1.379.598LOC_Os06g37150.1.379.598LOC_Os09g20090.1.316.555LOC_Os09g20090.1.316.555
Panicum virgatumPavirv00010476mPavirv00034691mPavirv00008852m.57.349Pavirv00008852m.57.349Pavirv00034692m
Pavirv00038723mPavirv00009193mPavirv00052126mPavirv00008852m.333.549Pavirv00008852m.333.549
Pavirv00027786mPavirv00058661m.257.479Pavirv00058661m.257.479
Physcomitrella patensPp1s308_11V6.1Pp1s1_590V6.1Pp1s144_8V6.1Pp1s194_194V6.1Pp1s60_109V6.1.84.354
Pp1s60_109V6.1.84.354Pp1s60_109V6.1.337.558Pp1s60_109V6.1.337.558
Phaseolus vulgarisPhvul.006G011700.1Phvul.006G011600.1Phvul.002G262200.1.79.351Phvul.002G262200.1.79.351Phvul.008G206900.1
Phvul.002G262200.1.338.549Phvul.002G262200.1.338.549
Picea abiesMA_19018g0010.88.322MA_19018g0010.88.322MA_10433807g0010MA_10431339g0010MA_10436713g0030.31.219
MA_10436713g0030.31.219MA_10436713g0030.228.409MA_10436713g0030.228.409MA_10436713g0010MA_19018g0010.319.548
MA_19018g0010.319.548MA_126229g0020MA_603008g0010.263.441MA_603008g0010.263.441MA_10128792g0010
Populus trichocarpaPotri.010G171700.1Potri.009G159700.1Potri.T079500.1Potri.005G079400.1.87.361Potri.005G079400.1.87.361
Potri.T079700.1.75.347Potri.T079700.1.75.347Potri.009G159700.2Potri.001G219300.2Potri.001G454700.1.90.354
Potri.001G454700.1.90.354Potri.007G088300.1Potri.001G219300.1Potri.T079700.1.300.544Potri.T079700.1.300.544
Potri.001G454700.1.344.552Potri.001G454700.1.344.552Potri.005G079400.1.337.560Potri.005G079400.1.337.560
Prunus persicappa003375mppa003411mppa005837mppa021554m
Ricinus communis29877.m00046929708.m000190
Setaria italicaSi006138mSi032784m.54.346Si032784m.54.346Si029363m.78.344Si029363m.78.344
Si003983m.82.360Si003983m.82.360Si006071m.87.371Si006071m.87.371Si015580m
Si029363m.324.547Si029363m.324.547Si032784m.326.546Si032784m.326.546Si006071m.368.591
Si006071m.368.591Si003983m.367.550Si003983m.367.550
Selaginella moellendorffii104957.46.417104957.46.417104957.368.570104957.368.570
Sorghum bicolorSb10g022430.1Sb10g022440.1.81.467Sb10g022440.1.81.467Sb02g023150.1.78.337Sb02g023150.1.78.337
Sb02g023140.1.79.351Sb02g023140.1.79.351Sb02g023160.1.88.358Sb02g023160.1.88.358Sb03g001450.1.79.370
Sb03g001450.1.79.370Sb02g023140.1.313.549Sb02g023140.1.313.549Sb02g023150.1.315.550Sb02g023150.1.315.550
Sb02g023160.1.346.558Sb02g023160.1.346.558Sb10g022440.1.382.605Sb10g022440.1.382.605Sb03g001450.1.355.568
Sb03g001450.1.355.568
Thellungiella halophilaThhalv10013093mThhalv10013113m.18.207Thhalv10013113m.18.207Thhalv10013113m.307.543Thhalv10013113m.307.543
Vitis viniferaGSVIVT01037479001GSVIVT01022165001GSVIVT01022172001GSVIVT01022168001GSVIVT01022181001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)