y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g41900.1
FamilyAA2
Protein PropertiesLength: 374 Molecular Weight: 41476.5 Isoelectric Point: 6.4235
ChromosomeChromosome/Scaffold: 1 Start: 38614959 End: 38616290
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2453180
  VVRDVVDSEVGMDHTLAPGLIRIFFHDCFITGCDASILLDESPAGDVPEKQSSANGFTLHGLRTIDIAKSTLEAMCPRTVSCSDIVAFAARDAAVAAGLP
  TYEVAAGRRDGEHSRMDDLPGNFPVPGHTVPRLTELFQKRGLSQEDLVVLSGAHSIGGAHCFMFSNRIYGFSKTADIDPSLDPAFAKLLREMCPRPKPDD
  NPEEAPKIDFDQRTAQKLDNSYYNELLARRSLLTSDSALVQDPATRPIVESFAKDDALWQKKFGEAMQKVGKLD
Full Sequence
Protein Sequence     Length: 374     Download
MARLTVAMLF FVLALALAPR NMDAVVVESL QPGFYNQSCP EVEQVVRDVV DSEVGMDHTL    60
APGLIRIFFH DCFITGCDAS ILLDESPAGD VPEKQSSANG FTLHGLRTID IAKSTLEAMC    120
PRTVSCSDIV AFAARDAAVA AGLPTYEVAA GRRDGEHSRM DDLPGNFPVP GHTVPRLTEL    180
FQKRGLSQED LVVLSGAHSI GGAHCFMFSN RIYGFSKTAD IDPSLDPAFA KLLREMCPRP    240
KPDDNPEEAP KIDFDQRTAQ KLDNSYYNEL LARRSLLTSD SALVQDPATR PIVESFAKDD    300
ALWQKKFGEA MQKVGKLDVL TRPEEGQIRR NCRMVNRPKS EMRTHMGRIS WPKPRHPMLQ    360
MMNWFIRGFQ QPA*                                                      420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase6.0e-626829932+
cd00314plant_peroxidase_like1.0e-1944316289+
pfam00141peroxidase1.0e-4446200155+
PLN03030PLN030301.0e-6333336309+
cd00693secretory_peroxidase5.0e-13730335306+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAH69321.1013701374TPA: class III peroxidase 79 precursor [Oryza sativa (japonica cultivar-group)]
GenBankEAZ00922.1013701374hypothetical protein OsI_22951 [Oryza sativa Indica Group]
RefSeqNP_001057625.10137017390Os06g0472900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001136779.102334329349hypothetical protein LOC100216922 [Zea mays]
RefSeqXP_002438389.1013361336hypothetical protein SORBIDRAFT_10g016100 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0303362303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1gw2_A0303362305A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid
PDB1hch_A0303362305A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid
PDB1atj_F0303362305A Chain A, Recombinant Horseradish Peroxidase C1a
PDB1atj_E0303362305A Chain A, Recombinant Horseradish Peroxidase C1a
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV531170264232860
DV514268260232820
DR811365258232800
DY687627254232760
DR809499249232710
Orthologous Group
SpeciesID
Glycine maxGlyma01g03310.1Glyma02g04290.1
Malus domesticaMDP0000875867MDP0000253572
Medicago truncatulaMedtr5g033470.1
Mimulus guttatusmgv1a008023m
Oryza sativaLOC_Os06g27850.1
Panicum virgatumPavirv00008311mPavirv00008781m
Phaseolus vulgarisPhvul.002G059600.1
Setaria italicaSi008411m
Sorghum bicolorSb10g016100.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny