y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g41970.2
FamilyGH13
Protein PropertiesLength: 912 Molecular Weight: 104717 Isoelectric Point: 6.2356
ChromosomeChromosome/Scaffold: 1 Start: 38708513 End: 38730034
DescriptionAlpha amylase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH134336997.4e-26
  EFMSSVLPHIKEAGYNAIQLIGVPEHKDYSSVGYKVTNYFAVSSRFGTPDDFKKLVDEAHGLGLLVLLDIVHSYASADELVGLSLYDGSNDCYFHSGKRG
  HHKYWGTRMFKYDDVDVLHFLLSNLNWWVTEYQIDGFQFHSLSSMLYTHNGFSTFTGAIEEYCNQYVDKDALIYLILANEMLHELHPDIITIAEDATYYP
  GLCEPTTQGGLGFDYWTNLSIPDMWLWHLENVPEREWSMSKIMKVLISSNHNMLSYVENHNQSISGR
Full Sequence
Protein Sequence     Length: 912     Download
MASCPLFLLV PHPPPPLVAI PRRHSPLPHI LTSCRSPLLS RQQSFRCRCS SSSSSSSSSG    60
PRERSPRPQQ QQGCTQQRPG RGSAVDPVGF LAKIGVSDRA FAQFLRDRHK AFKDRKWEMH    120
SRFIDLKEAS SGFDLLGLHR HRQHRVDFMD WAPGARYCSL VGDFNQWSAT ENCAREGHLG    180
HDDFGYWFVI LEDKLREGQE ADEYFFQEYN YVDDYDKGDN GVNAEDLIRR MNEEYWEPGE    240
VKSRRSRLET VAKLYEQMFG PNGPQTEEEL GEIPDAETRY KNWKATQKDD LSSSSPSYDI    300
IDTGQDFDIF NVVTDRASFE KFQAKATPLA YWVEMRKGRK AWIEKYVPAI SHKDKYRVYF    360
NTPDGALERV PAWATYVLPD AEGMQSYAVH WEPPPEEIYK WRFQRPKIKG SLRIYECHVG    420
ISGSEQKISS FQEFMSSVLP HIKEAGYNAI QLIGVPEHKD YSSVGYKVTN YFAVSSRFGT    480
PDDFKKLVDE AHGLGLLVLL DIVHSYASAD ELVGLSLYDG SNDCYFHSGK RGHHKYWGTR    540
MFKYDDVDVL HFLLSNLNWW VTEYQIDGFQ FHSLSSMLYT HNGFSTFTGA IEEYCNQYVD    600
KDALIYLILA NEMLHELHPD IITIAEDATY YPGLCEPTTQ GGLGFDYWTN LSIPDMWLWH    660
LENVPEREWS MSKIMKVLIS SNHNMLSYVE NHNQSISGRK SFAEIVLNTG MSSSGSVDDD    720
LIFRASSLLK IIKLITFTTS GGAYLNFMGN EFAHPKRVEF PMSSNDYSFH LAYRQWELLD    780
KGVHKNVFNF DKDIMTLDEN ERIISRGSLN IHHCDDTNMV ISFTRGPFLF VFNFNPDVPY    840
QLYRIGVDEA GEYQLILNTD ETKYGGCGEL NSSQYMKRTN DKRVDGCRNS LELTLASRSA    900
QVYKLVRILR I*                                                        960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02447PLN024471.0e-89919395+
cd11321AmyAc_bac_euk_BE3.0e-167395792406+
PLN02960PLN02960085911830+
PLN03244PLN03244083911840+
PLN02447PLN024470347906572+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26672.10399114896unnamed protein product [Vitis vinifera]
RefSeqNP_001057611.1019111903Os06g0367100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001108121.1019111899starch branching enzyme III [Zea mays]
RefSeqNP_001154629.108391167899alpha-amylase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002455921.102991131906hypothetical protein SORBIDRAFT_03g027310 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0348870114650A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A0348870114650A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0348870114650A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG9533872815197990
JG6363292703566250
CB6442302551333870
CV7621642425808210
BF2725172783696460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2Bradi5g09170.1
Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)