y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g42556.1
FamilyGT92
Protein PropertiesLength: 503 Molecular Weight: 56432.2 Isoelectric Point: 9.5292
ChromosomeChromosome/Scaffold: 1 Start: 39807484 End: 39812139
DescriptionDomain of unknown function (DUF23)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT922424510
  EYLYCGSSLYGNLSAPRLREWLAYHARFFGPRSHFVLHDAGGVSPEVRAVLDPWVRAGRVTVQDIRAQAEYDGYYYNQFLVVNDCLHRYRHAANWTFFFD
  VDEYMYLPDGRTLEEVLGQLQRYTQFTIEQNPMSSKLCLEDPAKEYSRKWGFEKLVFRNSITGVRRDRKYAVQARNAYSAGVHMSQNVYGRTTHRTESLI
  RYYHYHNTIN
Full Sequence
Protein Sequence     Length: 503     Download
MKPAVKKDAG GVGGGAFGIS CLDIKSFAAS LALLTLIMAL WQLHPCQPLL AITRSPSCPI    60
LPLSHTTNAT AALPSSTTKL PSSNFTTDRA PPTAAAARPA PLRDPNKREL RPYGSAAALF    120
VQMGAYRGGP RTFAVVGLAS KPAFVFNTPY FKCEWVPNPG AGEPVRTKAY KMLPDWGYGR    180
VYTVVVVNCT FPSNPNAGNR GGKLLVHAYY STKSRRYERF LALEEAPGSY DESRFRPPFP    240
YEYLYCGSSL YGNLSAPRLR EWLAYHARFF GPRSHFVLHD AGGVSPEVRA VLDPWVRAGR    300
VTVQDIRAQA EYDGYYYNQF LVVNDCLHRY RHAANWTFFF DVDEYMYLPD GRTLEEVLGQ    360
LQRYTQFTIE QNPMSSKLCL EDPAKEYSRK WGFEKLVFRN SITGVRRDRK YAVQARNAYS    420
AGVHMSQNVY GRTTHRTESL IRYYHYHNTI NVMGEPCREF VSKPTNGSKV TFEGIPYVYD    480
DNMKRLAGDI KHFEEATVGP TS*                                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_44.0e-9256358104+
pfam01697Glyco_transf_922.0e-28241481267+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN33511.1014991519unknown [Zea mays]
RefSeqNP_001057533.101949924517Os06g0328800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001143123.1014991518hypothetical protein LOC100275601 [Zea mays]
RefSeqNP_001145321.1014991521hypothetical protein LOC100278639 [Zea mays]
RefSeqXP_002436975.1014991518hypothetical protein SORBIDRAFT_10g013010 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK2088693161734880
EL6817702811644440
CO4616862911934830
EC8795392711544190
ES7990923171064220
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00278.2Aquca_030_00278.1Aquca_007_00975.1
Arabidopsis lyrata492851494517902431
Arabidopsis thalianaAT5G44670.1AT4G20170.1AT2G33570.1AT5G48190.1AT3G60990.1
AT3G07380.1
Brachypodium distachyonBradi1g35710.2Bradi1g35710.1Bradi3g53170.1
Brassica rapaBra020933Bra033759Bra022944Bra005484
Carica papayaevm.model.supercontig_1291.2evm.model.supercontig_36.102
Capsella rubellaCarubv10004512mCarubv10026267mCarubv10023079m
Citrus clementinaCiclev10014882m
Citrus sinensisorange1.1g009350m
Cucumis sativusCucsa.049020.1
Eucalyptus grandisEucgr.E04328.1Eucgr.F03619.1
Fragaria vescamrna19924.1-v1.0-hybridmrna29146.1-v1.0-hybrid
Glycine maxGlyma09g05300.2Glyma15g16630.1Glyma16g14690.1Glyma08g36030.2
Gossypium raimondiiGorai.008G052100.1Gorai.007G359700.1Gorai.006G138000.1
Linum usitatissimumLus10008076Lus10038387Lus10024731Lus10036247
Malus domesticaMDP0000126481MDP0000126479MDP0000661922MDP0000203716
Manihot esculentacassava4.1_005572mcassava4.1_005594mcassava4.1_006235m
Medicago truncatulaMedtr8g070700.1
Mimulus guttatusmgv1a004537mmgv1a005071m
Oryza sativaLOC_Os06g22330.1LOC_Os02g48190.1LOC_Os06g41910.1
Panicum virgatumPavirv00018157mPavirv00039959mPavirv00055571mPavirv00069450mPavirv00047984m
Pavirv00032304m
Physcomitrella patensPp1s35_57V6.1Pp1s98_254V6.1Pp1s198_141V6.1Pp1s227_17V6.1Pp1s35_63V6.1
Pp1s32_144V6.1Pp1s112_159V6.1Pp1s237_6V6.1Pp1s225_53V6.1Pp1s556_1V6.1
Pp1s25_268V6.1Pp1s401_34V6.1Pp1s88_162V6.1
Phaseolus vulgarisPhvul.009G244900.1Phvul.003G275200.1
Picea abiesMA_2788g0010MA_102296g0010MA_630451g0010MA_127644g0010MA_169299g0010
MA_43513g0010MA_401686g0010MA_10433350g0010MA_99230g0010MA_960165g0010.252.357
MA_960165g0010.252.357MA_960165g0010.360.466MA_960165g0010.360.466MA_898638g0010
Populus trichocarpaPotri.001G074600.1Potri.003G156600.1Potri.005G258900.1
Prunus persicappa004238mppa025548m
Ricinus communis28563.m00009330170.m014246
Setaria italicaSi017001mSi006264m
Selaginella moellendorffii77156406883
Sorghum bicolorSb10g013010.1Sb10g024570.1Sb04g030080.1
Thellungiella halophilaThhalv10024965mThhalv10000855mThhalv10016550m
Vitis viniferaGSVIVT01010061001GSVIVT01013454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)