y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g42690.1
FamilyGH1
Protein PropertiesLength: 502 Molecular Weight: 57498.8 Isoelectric Point: 8.2311
ChromosomeChromosome/Scaffold: 1 Start: 40000476 End: 40005973
Descriptionbeta glucosidase 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1275000
  RSQFPPEFMFGTASSAYQYEGAVREGGRGPSIWDTFTHNHPDKIANGSTGDVAIDSYHRYKDDVSIMKDLGFDAYRFSLSWSRILPSGKPSGGVNIEGIK
  YYNNLIDKLISKGIEPFVTLFHWDSPQVLEQQYGGFLSHLIVEDFHDYANICFREFGDRVKYWITLNEPWSFSVGGYSSGILAPGRCSSRQKSGCSMGDS
  GKEPYIVAHNQLLAHASAVQVYRDKYQMEQKGKIGITIVSNWITPYSNSKEDNDATKRAMDFMYGWFMDPLTKGDYPLSMKTLVGSRLPKFTKEQARALN
  GSFDFIGLNYYSARYAQNTKHNCKINKSYSTDSRANQRVERNGTYIGPKAGSSWLYIYPKGIEELLLYTKETYNNPTIYITENGVDEINNENLPLQEALA
  DNTRIEFYRQHIFHVLRALREGVDVRGYFAWSLFDNFEWMDGYSVRFGLNYVNYKDGLKRYPKRSSQWFQKFLH
Full Sequence
Protein Sequence     Length: 502     Download
MSFVLMILLS LTALQLQVDT TPSEIKRSQF PPEFMFGTAS SAYQYEGAVR EGGRGPSIWD    60
TFTHNHPDKI ANGSTGDVAI DSYHRYKDDV SIMKDLGFDA YRFSLSWSRI LPSGKPSGGV    120
NIEGIKYYNN LIDKLISKGI EPFVTLFHWD SPQVLEQQYG GFLSHLIVED FHDYANICFR    180
EFGDRVKYWI TLNEPWSFSV GGYSSGILAP GRCSSRQKSG CSMGDSGKEP YIVAHNQLLA    240
HASAVQVYRD KYQMEQKGKI GITIVSNWIT PYSNSKEDND ATKRAMDFMY GWFMDPLTKG    300
DYPLSMKTLV GSRLPKFTKE QARALNGSFD FIGLNYYSAR YAQNTKHNCK INKSYSTDSR    360
ANQRVERNGT YIGPKAGSSW LYIYPKGIEE LLLYTKETYN NPTIYITENG VDEINNENLP    420
LQEALADNTR IEFYRQHIFH VLRALREGVD VRGYFAWSLF DNFEWMDGYS VRFGLNYVNY    480
KDGLKRYPKR SSQWFQKFLH Q*                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029984.0e-1526499498+
PLN02849PLN028493.0e-1551499503+
PLN02814PLN028142.0e-1568500501+
TIGR03356BGL4.0e-16831495469+
pfam00232Glyco_hydro_1029498476+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC80501.102550028503hypothetical protein OsI_22753 [Oryza sativa Indica Group]
RefSeqNP_001057511.1025500130579Os06g0320200 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ5Z9Z002550028503BGL24_ORYSJ RecName: Full=Beta-glucosidase 24; Short=Os6bglu24; Flags: Precursor
RefSeqXP_002285582.1015019509PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438325.102344525447hypothetical protein SORBIDRAFT_10g012220 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B02549929503B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB3ptq_A02549929503B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB3ptm_B02549929503B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB3ptm_A02549929503B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB3ptk_B02549929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
tea aroma glycosidic precursor bioactivationRXN-13691EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13692EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13693EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13694EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13695EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13696EC-3.2.1.149β-primeverosidase
tea aroma glycosidic precursor bioactivationRXN-13701EC-3.2.1.149β-primeverosidase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794849467234890
FG227815487144990
HO779715446444890
EE59059049845010
HO80949735133450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00091.17Aquca_057_00091.16Aquca_002_00803.1Aquca_018_00061.1Aquca_018_00060.1
Aquca_002_01227.1Aquca_018_00055.1Aquca_005_00383.1Aquca_002_01227.2Aquca_058_00026.3
Aquca_058_00026.2Aquca_058_00026.1Aquca_018_00092.2Aquca_018_00058.5Aquca_018_00058.3
Aquca_018_00058.2Aquca_018_00058.1Aquca_020_00298.1Aquca_057_00089.1Aquca_018_00058.4
Aquca_057_00090.1Aquca_018_00092.1Aquca_057_00091.1Aquca_057_00090.2Aquca_057_00091.2
Aquca_018_00058.6Aquca_057_00089.2Aquca_018_00058.9Aquca_057_00091.3Aquca_002_01227.4
Aquca_057_00091.4Aquca_057_00091.5Aquca_057_00090.3Aquca_057_00091.6Aquca_057_00089.4
Aquca_057_00091.9Aquca_057_00091.11Aquca_057_00091.10Aquca_057_00091.7Aquca_002_01227.3
Aquca_018_00060.2Aquca_018_00058.8Aquca_018_00058.7Aquca_005_00383.2Aquca_057_00089.6
Aquca_057_00091.8Aquca_057_00091.12Aquca_057_00091.15Aquca_057_00091.14Aquca_057_00091.13
Aquca_057_00089.5Aquca_057_00089.3Aquca_057_00090.5Aquca_057_00090.4Aquca_058_00026.4
Aquca_058_00026.7Aquca_058_00026.6Aquca_058_00026.5Aquca_011_00260.1Aquca_018_00058.10
Aquca_020_00298.2
Arabidopsis lyrata472753495536479295479297493685
483573486481486479903867494520
870958483572903873862845486477
903868474221891388474259882771
909775478241316517.403.882898581474364
475732477608902351873493481414
Arabidopsis thalianaAT3G60130.3AT1G26560.1AT5G54570.1AT3G18080.1AT5G36890.2
AT5G36890.1AT3G18070.1AT5G44640.1AT2G44480.1AT5G42260.1
AT3G60140.1AT5G24550.1AT2G44450.1AT3G60130.1AT2G44480.2
AT2G25630.1AT2G44490.1AT5G24540.1AT3G60120.1AT2G44470.3
AT2G44460.1AT1G47600.1AT1G47600.2AT1G51470.1AT3G09260.1
AT1G52400.3AT1G52400.1AT3G21370.1AT3G18070.2AT2G44470.1
AT3G60130.2AT2G44470.2AT1G75940.1AT1G66280.1AT1G66270.1
AT5G28510.1AT1G66270.2AT1G52400.2AT3G03640.1AT2G32860.1
AT2G32860.2
Brachypodium distachyonBradi1g70170.1Bradi3g00650.1Bradi1g33040.1Bradi5g13260.1Bradi1g10930.1
Bradi1g10940.1Bradi2g57640.2Bradi1g19270.1Bradi5g13270.1Bradi1g10917.1
Bradi4g08040.1Bradi3g40007.1Bradi1g70170.2Bradi3g39997.1Bradi3g40007.2
Bradi1g33040.2Bradi1g10890.1
Brassica rapaBra016276Bra024709Bra002978Bra021291Bra035347
Bra021292Bra039970Bra014510Bra039501Bra004835
Bra007510Bra007508Bra004836Bra027873Bra003401
Bra037651Bra019555Bra004833Bra014511.16.492Bra014511.16.492
Bra004837.31.507Bra004837.31.507Bra030473Bra023886Bra008230
Bra030386Bra018969Bra034060Bra001320Bra026178
Bra029755Bra036447Bra005551Bra007507Bra005550
Bra004839Bra037648Bra014511.517.919Bra014511.517.919Bra007509.170.498
Bra007509.170.498Bra021815Bra004840Bra037647Bra004838
Carica papayaevm.model.supercontig_1.109evm.model.supercontig_1.110evm.model.supercontig_3.438evm.model.supercontig_116.16evm.model.supercontig_116.17
evm.model.supercontig_444.2evm.model.supercontig_444.3evm.model.supercontig_189.36evm.model.supercontig_561.1evm.TU.contig_29746.1
evm.model.supercontig_444.5evm.model.supercontig_561.2
Capsella rubellaCarubv10008883mCarubv10004671mCarubv10015846mCarubv10013483mCarubv10017031m
Carubv10016921mCarubv10003612mCarubv10023032mCarubv10027948mCarubv10023074m
Carubv10025373mCarubv10011244mCarubv10003435mCarubv10021512mCarubv10002504m
Carubv10011864mCarubv10021313mCarubv10011610mCarubv10013440mCarubv10021944m
Carubv10008823mCarubv10015888mCarubv10003292m
Citrus clementinaCiclev10031299mCiclev10031250mCiclev10031209mCiclev10031416mCiclev10031262m
Ciclev10008010mCiclev10013521mCiclev10013421mCiclev10013386mCiclev10031180m
Ciclev10031179mCiclev10031178mCiclev10015030mCiclev10017777mCiclev10004010m
Ciclev10031212mCiclev10031695mCiclev10008499mCiclev10033361mCiclev10023390m
Ciclev10015383mCiclev10031421mCiclev10031352mCiclev10031349mCiclev10008012m
Ciclev10015719mCiclev10015718mCiclev10015201m.131.448Ciclev10015201m.131.448Ciclev10016154m
Citrus sinensisorange1.1g010588morange1.1g009780morange1.1g010049morange1.1g046891morange1.1g036937m
orange1.1g036948morange1.1g011145morange1.1g040688morange1.1g009642morange1.1g036046m
orange1.1g015451morange1.1g015449morange1.1g014137morange1.1g015209morange1.1g015526m
orange1.1g015517morange1.1g015175morange1.1g015166morange1.1g015181morange1.1g014810m
orange1.1g014785morange1.1g012937morange1.1g040158morange1.1g016924morange1.1g018102m
orange1.1g016897morange1.1g017199morange1.1g012826m.131.448orange1.1g012826m.131.448orange1.1g023097m
orange1.1g015710morange1.1g023712m
Cucumis sativusCucsa.143190.1Cucsa.143200.1Cucsa.327780.1Cucsa.143110.2Cucsa.143110.1
Cucsa.121830.1Cucsa.189380.5Cucsa.189380.1Cucsa.143120.1Cucsa.189380.7
Cucsa.121830.2Cucsa.143150.1Cucsa.053330.1Cucsa.029410.1Cucsa.143140.1
Cucsa.327780.2Cucsa.050040.1Cucsa.050040.2Cucsa.108330.1Cucsa.121830.3
Cucsa.029410.6Cucsa.029410.2Cucsa.338070.1Cucsa.029410.3.145.464Cucsa.029410.3.145.464
Eucalyptus grandisEucgr.B03653.2Eucgr.B03653.1Eucgr.J00833.1Eucgr.J00833.2Eucgr.G02458.1
Eucgr.B03654.1Eucgr.B00860.1Eucgr.B03659.1Eucgr.F03394.1Eucgr.B00859.6
Eucgr.B00859.2Eucgr.B00859.5Eucgr.B00859.8Eucgr.B00859.4Eucgr.B00859.7
Eucgr.B00859.3Eucgr.B00859.9Eucgr.B00859.1Eucgr.B01453.1Eucgr.J00833.3
Eucgr.B00859.10Eucgr.G03404.1Eucgr.K00916.1Eucgr.J01459.1Eucgr.B03656.1
Eucgr.J01543.1Eucgr.B00859.12Eucgr.B00859.11Eucgr.B00136.1Eucgr.B01453.3
Eucgr.B01453.2Eucgr.H02811.1Eucgr.H02811.2Eucgr.B03657.1Eucgr.B00914.1
Eucgr.B03661.1
Fragaria vescamrna20643.1-v1.0-hybridmrna03278.1-v1.0-hybridmrna20642.1-v1.0-hybrid.501.982mrna20642.1-v1.0-hybrid.501.982mrna20640.1-v1.0-hybrid
mrna20642.1-v1.0-hybrid.37.483mrna20642.1-v1.0-hybrid.37.483mrna20639.1-v1.0-hybrid.42.488mrna20639.1-v1.0-hybrid.42.488mrna20639.1-v1.0-hybrid.42.488
mrna09410.1-v1.0-hybrid.42.503mrna09410.1-v1.0-hybrid.42.503mrna20641.1-v1.0-hybridmrna26798.1-v1.0-hybridmrna26794.1-v1.0-hybrid
mrna08509.1-v1.0-hybridmrna15314.1-v1.0-hybridmrna00445.1-v1.0-hybridmrna10205.1-v1.0-hybrid
Glycine maxGlyma20g03210.1Glyma11g13830.1Glyma11g13820.1Glyma12g15620.1Glyma11g13810.1
Glyma12g05800.1Glyma12g05830.1Glyma11g13800.1Glyma07g11310.1Glyma12g05780.1
Glyma12g05811.1.523.998Glyma12g05811.1.523.998Glyma09g30910.1Glyma11g13780.2Glyma06g41200.1
Glyma11g13850.1Glyma12g05811.1.41.512Glyma12g05811.1.41.512Glyma12g05790.1Glyma12g05821.1
Glyma12g36870.1Glyma09g00550.1Glyma12g05780.2Glyma11g16220.1Glyma11g13863.1
Glyma15g42590.1Glyma12g05770.1Glyma15g42570.1Glyma01g06980.1Glyma15g42590.2
Glyma15g42590.3Glyma12g05770.2Glyma06g41200.2Glyma11g13863.2Glyma15g03610.1
Glyma09g00550.2Glyma15g03620.3Glyma13g41800.1Glyma08g15931.1
Gossypium raimondiiGorai.013G093000.1Gorai.013G093100.1Gorai.013G165100.1Gorai.010G128100.1Gorai.001G086300.1
Gorai.003G088100.1Gorai.002G250900.1Gorai.006G057000.2Gorai.006G057000.1Gorai.002G251200.1
Gorai.002G252700.1Gorai.007G349700.1Gorai.013G165100.3Gorai.013G165100.2Gorai.007G342700.1
Gorai.003G088100.2Gorai.007G349700.2Gorai.008G271500.2Gorai.008G271500.6Gorai.008G271500.5
Gorai.008G271500.3Gorai.008G271500.1Gorai.004G271500.1Gorai.013G165100.4Gorai.002G250800.1
Gorai.001G086200.1Gorai.002G252800.1Gorai.002G251100.1Gorai.003G088100.3Gorai.007G349700.3
Gorai.013G093000.2Gorai.013G093100.2Gorai.008G271500.7Gorai.002G255400.1
Linum usitatissimumLus10030520Lus10030515.45.290Lus10030515.45.290Lus10039541Lus10030576
Lus10031235Lus10004654Lus10037098Lus10031234Lus10036885
Lus10031251Lus10031808Lus10009644Lus10009218Lus10024941
Lus10022883Lus10026057Lus10037988Lus10019531Lus10026657
Lus10020232Lus10024065Lus10012687Lus10003915Lus10008503
Lus10037987Lus10037473Lus10024152Lus10036445Lus10030516
Lus10039513Lus10030577Lus10012869Lus10030911Lus10030518
Lus10012871Lus10011828.51.470Lus10011828.51.470Lus10009013
Malus domesticaMDP0000177079MDP0000047589MDP0000940742MDP0000217844MDP0000047586
MDP0000047584MDP0000194076MDP0000291373MDP0000315254MDP0000301022
MDP0000131298MDP0000310422MDP0000234499MDP0000322237MDP0000177891
MDP0000306634MDP0000171945MDP0000124290
Manihot esculentacassava4.1_005766mcassava4.1_027713mcassava4.1_022953mcassava4.1_005890mcassava4.1_005935m
cassava4.1_028433mcassava4.1_031067mcassava4.1_032229mcassava4.1_005555mcassava4.1_032518m
cassava4.1_031101mcassava4.1_006336mcassava4.1_021468mcassava4.1_033294mcassava4.1_033687m
cassava4.1_006078mcassava4.1_029420mcassava4.1_029644mcassava4.1_029195mcassava4.1_024320m
cassava4.1_025199mcassava4.1_021061mcassava4.1_032853mcassava4.1_022562mcassava4.1_005140m
cassava4.1_005099mcassava4.1_005127mcassava4.1_031399mcassava4.1_008514mcassava4.1_008910m
cassava4.1_024585mcassava4.1_023547mcassava4.1_023753mcassava4.1_006309mcassava4.1_029035m
cassava4.1_021008mcassava4.1_031777mcassava4.1_032669mcassava4.1_033426mcassava4.1_030038m
cassava4.1_027570mcassava4.1_024736m
Medicago truncatulaMedtr4g083000.1Medtr6g078450.1Medtr2g098520.1Medtr2g098540.1Medtr6g078330.1
Medtr2g098790.1Medtr4g023000.1Medtr1g024230.1Medtr3g033810.1Medtr3g033790.1
Medtr2g098540.2Medtr5g071520.1Medtr3g026620.1Medtr6g078380.1Medtr4g083000.2
Medtr5g044000.1Medtr4g015420.1Medtr4g015460.1
Mimulus guttatusmgv1a004935mmgv1a004939mmgv1a004736mmgv1a004735mmgv1a005186m
mgv1a003998mmgv1a019285mmgv1a023593mmgv1a006010mmgv1a025215m
mgv1a018115mmgv1a023610mmgv1a007486m
Oryza sativaLOC_Os03g49600.3LOC_Os03g49600.4LOC_Os03g49600.5LOC_Os07g46280.3LOC_Os03g11420.1
LOC_Os10g17650.1LOC_Os04g39864.4LOC_Os04g39900.1LOC_Os04g39880.1LOC_Os06g21570.1
LOC_Os06g46940.2LOC_Os08g39860.1LOC_Os03g49600.1LOC_Os01g32364.1LOC_Os03g49610.1
LOC_Os04g39864.2LOC_Os04g39864.1LOC_Os09g31430.1LOC_Os04g39840.1LOC_Os07g46280.2
LOC_Os07g46280.1LOC_Os01g67220.2LOC_Os01g67220.1LOC_Os12g23170.1LOC_Os03g49600.2
LOC_Os08g39870.1LOC_Os08g39860.2LOC_Os04g39880.3LOC_Os09g31410.2LOC_Os01g67220.3
LOC_Os04g39864.3LOC_Os04g39840.2LOC_Os09g31410.1LOC_Os04g39880.2
Panicum virgatumPavirv00051200mPavirv00060534mPavirv00028838mPavirv00016406mPavirv00044049m
Pavirv00009878mPavirv00019362mPavirv00009209mPavirv00028606mPavirv00045170m
Pavirv00023219mPavirv00056349mPavirv00006498mPavirv00014366mPavirv00014652m
Pavirv00048559mPavirv00059288mPavirv00040392mPavirv00039075mPavirv00011800m
Pavirv00011881mPavirv00010618mPavirv00012763mPavirv00000268mPavirv00048108m
Pavirv00064104mPavirv00016143mPavirv00048764mPavirv00020600mPavirv00052544m
Pavirv00019371mPavirv00004209mPavirv00057104mPavirv00036679mPavirv00057898m
Pavirv00026589mPavirv00064801mPavirv00015749m
Physcomitrella patensPp1s9_78V6.2Pp1s9_78V6.3Pp1s9_78V6.1Pp1s138_14V6.1Pp1s76_8V6.2
Pp1s76_8V6.1Pp1s137_79V6.1Pp1s114_133V6.3Pp1s114_133V6.2Pp1s114_133V6.1
Pp1s110_112V6.1Pp1s1_726V6.1Pp1s39_162V6.1Pp1s170_62V6.1
Phaseolus vulgarisPhvul.002G102800.1Phvul.003G043600.1Phvul.011G056300.1Phvul.011G055800.1Phvul.001G076700.1
Phvul.011G056100.1Phvul.005G151400.1Phvul.011G056200.1Phvul.011G145900.1Phvul.004G151800.1
Phvul.011G202000.2Phvul.005G150600.1Phvul.011G201700.1Phvul.005G151500.1Phvul.004G100700.1
Phvul.011G214300.1Phvul.011G056000.1Phvul.011G055900.1Phvul.005G151300.1Phvul.011G202500.1
Phvul.005G035300.1Phvul.011G056400.1Phvul.005G151700.1Phvul.005G039200.1Phvul.005G151800.1
Phvul.005G151200.1Phvul.005G039100.1Phvul.005G151600.1Phvul.011G202000.1.132.578Phvul.011G202000.1.132.578
Phvul.011G201700.2Phvul.011G055700.1Phvul.005G039200.2
Picea abiesMA_71765g0010MA_4535g0010MA_484764g0010MA_119005g0010MA_10394370g0010
MA_8591669g0010MA_48585g0010MA_82706g0010MA_8849054g0010MA_488148g0010
MA_483593g0010MA_8033g0010MA_10344118g0010MA_356467g0010MA_10425819g0010
MA_10426205g0010
Populus trichocarpaPotri.004G110200.1Potri.004G109200.1Potri.008G094200.3Potri.008G094200.2Potri.008G094200.1
Potri.010G159900.1Potri.004G040700.2Potri.001G409900.1Potri.004G040700.1Potri.015G041300.2
Potri.015G041300.1Potri.001G227300.1Potri.010G178800.1Potri.001G409900.2Potri.005G059500.1
Potri.003G211100.1Potri.001G227300.2Potri.001G223500.1Potri.001G223800.1Potri.T018600.1
Potri.001G223300.1Potri.001G222900.1Potri.001G227200.1Potri.001G223400.1Potri.001G223900.1
Potri.019G010800.1Potri.002G219600.1Potri.001G223700.1Potri.001G223600.1Potri.012G049300.1
Potri.T018000.1Potri.001G222800.1Potri.001G227400.1Potri.001G227300.3Potri.001G227400.2
Potri.001G224000.1Potri.001G227400.3Potri.001G226000.1Potri.001G226200.1Potri.001G226100.1
Potri.001G225900.1Potri.004G040700.3Potri.001G226100.3Potri.001G225900.4Potri.001G226100.4
Potri.001G226100.2Potri.001G225900.5Potri.001G225900.2Potri.001G225900.3Potri.001G226100.5
Potri.001G225900.6Potri.001G409900.3Potri.010G178800.2Potri.001G015100.1Potri.001G227400.4
Potri.001G227400.5
Prunus persicappa015619mppa024434mppa018404mppa015887mppa020817m
ppa019137mppa025067mppa020067mppa020368mppa017981m
ppa015970mppa023565mppa017484mppa004108mppa019573m
ppa015161mppa004226mppa003856mppa024193mppa004380m
ppa019262mppa020839mppa021137mppa026448mppa021158m
ppa018933mppa003831mppa022045mppa004288mppa004358m
ppa022513mppa025259mppa003891mppa003718mppa016757m
ppa024653mppa006142mppa005036mppa024630mppa006110m
ppa019518mppa025619mppa024207mppa027189mppa021225m
ppa004368mppa007195mppa023264mppa006903mppa016583m
ppa025840m
Ricinus communis30174.m00912530169.m00638630226.m00197829924.m00009530169.m006385
29808.m00089129929.m00450929878.m00023030226.m00198229808.m000892
30226.m00197730226.m001984
Setaria italicaSi008435mSi011994mSi009896mSi034989mSi009910m
Si006286mSi035308mSi029536mSi029542mSi006283m
Si001247mSi034935mSi029565mSi035979mSi035887m
Si035908mSi001611mSi002035mSi036104mSi024527m
Selaginella moellendorffii1279641535348886375234268319
14985116382222861276384163827
2685271442957674844022698083
151109
Sorghum bicolorSb06g019840.1Sb01g043030.1Sb10g027600.1Sb06g019860.1Sb06g019880.1
Sb01g010840.1Sb06g019850.1Sb01g010825.1Sb01g010830.1Sb02g041550.1
Sb03g008350.1Sb10g012220.1Sb03g042690.1Sb02g028400.1Sb10g028060.1
Sb01g013360.1Sb06g019830.1Sb08g007570.1Sb03g008350.2Sb08g007610.1
Sb01g010840.2Sb08g007586.1Sb08g007650.1
Thellungiella halophilaThhalv10021024mThhalv10007404mThhalv10020536mThhalv10020535mThhalv10027734m
Thhalv10001416mThhalv10005858mThhalv10023359mThhalv10005895mThhalv10010985m
Thhalv10023064mThhalv10001726mThhalv10018387mThhalv10012352mThhalv10011400m
Thhalv10011399mThhalv10005886mThhalv10001354mThhalv10001744mThhalv10001770m
Thhalv10001756mThhalv10016402mThhalv10001748mThhalv10001447mThhalv10005980m
Thhalv10020699mThhalv10018390mThhalv10011384mThhalv10020506mThhalv10011385m
Thhalv10020508mThhalv10022406mThhalv10020507mThhalv10001865mThhalv10020496m
Vitis viniferaGSVIVT01012192001GSVIVT01032007001GSVIVT01012191001GSVIVT01032149001GSVIVT01032018001.82.547
GSVIVT01032018001.82.547GSVIVT01014551001GSVIVT01032023001.188.661GSVIVT01032023001.188.661GSVIVT01032014001
GSVIVT01008398001GSVIVT01032005001GSVIVT01032015001GSVIVT01032004001GSVIVT01030881001
GSVIVT01025344001.68.542GSVIVT01025344001.68.542GSVIVT01025344001.68.542GSVIVT01025343001GSVIVT01003999001
Zea maysAC217401.3_FGT001AC217401.3_FGT002AC155376.2_FGT005AC234160.1_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)