y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g44777.1
FamilyGH16
Protein PropertiesLength: 304 Molecular Weight: 33577.5 Isoelectric Point: 4.8586
ChromosomeChromosome/Scaffold: 1 Start: 42895398 End: 42896745
Descriptionxyloglucan endotransglucosylase/hydrolase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16602245.1e-24
  IRLTLDRRNGAGAGFVSKLRFGSGFFHMRIKVPSGYTAGVVTAFYLASDSSAPDRDEVDFEFLGNVDGKPITLQTNVFVNGHGDREQRLSLWFDPAADFH
  DYRILWNCFQIVLFVDETPVRVLRNLTGSVPDYEFPEKQMVVQGSVWDGSDWATDGGRTKVDWSR
Full Sequence
Protein Sequence     Length: 304     Download
MAASNVQPWL LLLLILLPAA LVSPQTAAAA PPQPTPAFDE NYVPSYGQDG YHLVDMGTEI    60
RLTLDRRNGA GAGFVSKLRF GSGFFHMRIK VPSGYTAGVV TAFYLASDSS APDRDEVDFE    120
FLGNVDGKPI TLQTNVFVNG HGDREQRLSL WFDPAADFHD YRILWNCFQI VLFVDETPVR    180
VLRNLTGSVP DYEFPEKQMV VQGSVWDGSD WATDGGRTKV DWSRGPFAAE FRGFDVAGCA    240
NTSSTPCDSQ SSPGMWWNGG GYRSLSAEQH AAYENVRNKY MNYDYCTDKG RFKNKLPAEC    300
SYA*                                                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00413Glyco_hydrolase_167.0e-1954224185+
cd02183GH16_fungal_CRH1_transglycosylase6.0e-2188236161+
pfam00722Glyco_hydro_163.0e-5738224188+
PLN03161PLN031613.0e-7238301273+
cd02176GH16_XET2.0e-12838300264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE65409.1038232628820hypothetical protein OsJ_20746 [Oryza sativa Japonica Group]
RefSeqNP_001057249.1038302483747Os06g0237400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150467.103730339302xyloglucan endotransglucosylase/hydrolase protein 1 [Zea mays]
RefSeqXP_002438131.103830335290hypothetical protein SORBIDRAFT_10g008540 [Sorghum bicolor]
RefSeqXP_002438132.103830330293hypothetical protein SORBIDRAFT_10g008550 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B0253012273A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1un1_A0253012273A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1umz_B0253012273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A0253012273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2vh9_B0103006290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ655637223382580
CJ655203196382310
CJ547849226813030
CO116549267383000
ES827892267383000
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g71937.1
Brassica rapaBra001434Bra015093Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny