y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g45890.1
FamilyCE10
Protein PropertiesLength: 717 Molecular Weight: 79122.7 Isoelectric Point: 5.1721
ChromosomeChromosome/Scaffold: 1 Start: 44183156 End: 44193172
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104616893e-27
  AYFYPPLNPMFQGLPDERPPLLVKTHGGPTAEAQGILDLSVQYWTSRGWAFLDVNYGGSTGYGREYRERLLEKWGIVDVDDCCSCARFLVENGKVDDQRL
  CITGRSAGGYTTLASLAFRDTFKAGASLYGVGDLSLLRAETHKFESHYMDSLVGNERAYYERSPINFVNKFTCPVILFQGLDDKVVPPDQARAIYKALKE
  KGLPVALVEYEGEQHGFRKAENIKFTLEQ
Full Sequence
Protein Sequence     Length: 717     Download
MATLLASIFL LPATCSASAP GLLLRGAIPR FRRALASPPR MSSSSASPAP AAAAAGEKPA    60
AAPYGSWRSP ITADVVSGAG KRLGGIALAG DGRLLWIEGR PEEKGRMVIV KEDDNPVDVI    120
PQEFAARTVA QEYGGGAFAV QDNVVVFSNY KDQRLYKQVT GTGSLPVPLT PDYGAPDVSY    180
ADGVFDPHFN RYVTVMEDRR KSSLNPTTTI ASINLSGGDV HEPKVLISGN DFYAFPRIDQ    240
NKMRMAWIEW GHPNMPWDKS ELWVGYFSEN GDLTKRVCVA GGNPMLVESP TEPKWSPKGQ    300
LFFISDRGSG FWNIYKWVEH TNEVVPVYTL DAEFTRPLWV FGISCYDFLG KSNHIILTYR    360
QLGRSYLGVL ECESGSVSLL DIPFSDLSDV VTGNDYFYIE GASASIPMSI AKVTLDESKA    420
KVVSFSIVWS SSPDVVQYKP FFSTPEFIEF PTSTPGQNAY AYFYPPLNPM FQGLPDERPP    480
LLVKTHGGPT AEAQGILDLS VQYWTSRGWA FLDVNYGGST GYGREYRERL LEKWGIVDVD    540
DCCSCARFLV ENGKVDDQRL CITGRSAGGY TTLASLAFRD TFKAGASLYG VGDLSLLRAE    600
THKFESHYMD SLVGNERAYY ERSPINFVNK FTCPVILFQG LDDKVVPPDQ ARAIYKALKE    660
KGLPVALVEY EGEQHGFRKA ENIKFTLEQQ MLFFARLVGK FEVADDITPI KIENFD*       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes3.0e-8539677163+
pfam07859Abhydrolase_33.0e-8539677162+
COG0412COG04127.0e-11444677244+
pfam00326Peptidase_S93.0e-45497700209+
COG1506DAP28.0e-64222701489+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC80224.105271620683hypothetical protein OsI_22153 [Oryza sativa Indica Group]
RefSeqNP_001057137.105271620683Os06g0215300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001152650.105771615674acylaminoacyl-peptidase1 [Zea mays]
RefSeqXP_002284264.10517162675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438048.1017161721hypothetical protein SORBIDRAFT_10g007270 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0627045653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0627045653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0607043653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A0607043653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B0607043653A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802165421817170
GO8785023392595970
GT0486783441294720
GO8782783242595820
GO8469023511645070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)