y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g46850.1
FamilyGT1
Protein PropertiesLength: 464 Molecular Weight: 47740.6 Isoelectric Point: 6.2857
ChromosomeChromosome/Scaffold: 1 Start: 45379204 End: 45380981
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12674411.5e-34
  ASDPHGCLAWLDRHPPRSVAYVSFGTVASPRQDELRELAAGLEASGAPFLWSLREDAWPLLPPGFLRLPAGLVVPWAPQVGVLRHASTGAFVTHAGWASV
  LEGLSNGVPMACRPFFGDQTMNARSVARVCGFGSAFEGPMTSAGVAEAVGSLLRGEEGERMRARAKELQAMVGAA
Full Sequence
Protein Sequence     Length: 464     Download
MAVPPHVAVV AFPFSSHAAV LLSFARALAA AAPAGTTLSF LTTAESIAQL QKGARLPGNL    60
RFVEIADGVS SGGAVLPPPR RMELFLAAAE AGGIRDGLEA ARASAGGAAV SCVVGDAFVL    120
VAADAASAAG APWVPVWTAA PCALLAHLRT DALRQDVGDH AASRGDELLT AHPGLGGYRV    180
RDLSDGVVSG DFNHVINRLL YRMAKRLPQS ATAVALNTFP GLDPPDLAAA LSAELPNCLP    240
LGPYHLLPAA AAAAADSPDE APAAEEASDP HGCLAWLDRH PPRSVAYVSF GTVASPRQDE    300
LRELAAGLEA SGAPFLWSLR EDAWPLLPPG FLRLPAGLVV PWAPQVGVLR HASTGAFVTH    360
AGWASVLEGL SNGVPMACRP FFGDQTMNAR SVARVCGFGS AFEGPMTSAG VAEAVGSLLR    420
GEEGERMRAR AKELQAMVGA AFRPGGGCRE NFDRFVKIVC GCL*                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00201UDPGT0.00343446027+
PLN02410PLN024104.0e-32209456256+
PLN02555PLN025552.0e-32273456198+
PLN03007PLN030072.0e-32271457206+
pfam00201UDPGT2.0e-9535419403+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAO43975.10446011469UDPglucose:flavonoid-3-oxy glucosyl transferase [Zea mays]
GenBankABF72121.10446011469UDP-glucose flavonoid-3-O-glucosyltransferase [Zea mays]
RefSeqNP_001105886.10446011469anthocyanidin 3-O-glucosyltransferase [Zea mays]
Swiss-ProtP14726044605453UFOG_HORVU RecName: Full=Anthocyanidin 3-O-glucosyltransferase; AltName: Full=Flavonol 3-O-glucosyltransferase; AltName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase; AltName: Full=Bronze-1
RefSeqXP_002436626.1044609470hypothetical protein SORBIDRAFT_10g006140 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A054598450A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB2c1z_A054598450A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB2c1x_A054598450A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A0646015453A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A0646015453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanin biosynthesis (delphinidin 3-O-glucoside)RXN-7815EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)PELUDP-RXNEC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG3856682701384070
EG3965742871384190
EG3782692232384600
FL8037452262404600
EG3805302501383840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)