y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g47427.1
FamilyGT48
Protein PropertiesLength: 1900 Molecular Weight: 217404 Isoelectric Point: 9.0084
ChromosomeChromosome/Scaffold: 1 Start: 45954122 End: 45971056
Descriptioncallose synthase 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48102117580
  VPTNLEARRRISFFTNSLFMEMPRAPRVRKMLSFSVMTPYYSEETVYSRSDLDLENEDGVSIIFYLQKIFPDEWNNFMERINCKRESEVWGNEENVLQLR
  HWASLRGQTLCRTVRGMMYYRKALKLQAFLDMASESEILEGYKAVADPAEEEKKSQRSLSSQLEAIADMKFTYVATCQIYGNQKQSGDRHATDILNLMVN
  YPGLRVAYIDEVEERDGDKVQKVFYSVLVKALDNHDQEIYRIKLPGPAKIGEGKPENQNHAIIFTRGEALQTIDMNQDNYLEEALKMRNLLEEFNESHGV
  RPPTILGVREHIFTGSVSSLAWFMSNQETSFVTIGQRVLANPLKVRFHYGHPDVFDRIFHITRGGISKASCGINLSEDIFAGFNSTLRRGNVTHHEYIQV
  GKGRDVGLNQISLFEAKVACGNGEQVLSRDIYRLGHRFDFFRMLSCYFTTVGFYVSSMMVVIIVYVFLYGRLYLALSGLEFAIMKQARMRGNRALQAAMG
  SQSIVQLGLLMALPMFMEIGLERGFRSALGDFIIMQLQLCSVFFTFSLGTKSHYFGRTILHGGAKYRATGRGFVVRHVKFAENYRMYSRSHFVKGLELLL
  LLVVYQIYGDVATDSIAYILLTSSMWFLVITWLFAPFLFNPSGFEWQKVVDDWDDWNKWISSRGGIGVPANKAWESWWEEEQEHLLSTGLVGRICEIILS
  FRFFMFQYGIMYHLNISNGNKSISVYGLSWLVIVAVVL
Full Sequence
Protein Sequence     Length: 1900     Download
MTTPARGGGD EPSSTASASA MNDPITPTSA MNRRGSRGAA MATFSMEVFD NEVVPSTLNS    60
IAPILRVAAE IESERPRVAY LCRFYAFEKA HRLDQNSVGR GVRQFKTALL QRLEKDNSLS    120
LAKRLKKSDA REIESFYQQY YENYVRALDK GEQADRAQLG KAYQTAGVLF EVLCAVNKTE    180
KVEEVNPEII RLHKDVQEKK DIYAPFNILP LDAASASQSV MQLEEIKASV TALRNTRGLT    240
WPSAFEPERQ KGGDLDLLDW LRAMFGFQRD SVRNQREHLI LLLANVHVRL EPKPEPLSKL    300
DDRAVDLVMN KLFNNYKKWC KFLSRKHSLR NPPGAQLQEI QQRKILYLGL YLLIWGESAN    360
IRFMPECLCY IFHNMAYELH GLLAGNVSIV TGENIRPSYG GDEEAFLKKV VTPIYRVIRK    420
EAGKSQHGKT PHSAWCNYDD LNEYFWTSDC FSLGWPMRDD GEFFKSVHDS RPAGSSSQKG    480
SSKSTGKTNF VETRTFWHIF RSFDRMWTFY LLALQAMLIF AWSDYSVSQI LQKDLLYSLS    540
SIFLTAAFLQ FLQSILDFSL NFPGHHRCKF IDAMRNILKI IVSAVWAVIL PFFYISTAAK    600
VNLPLRDLQK WFGYVKGVPP LYILAVAVYL IPNIISAALF LFPMFRRWIE NSDWHIVRLL    660
LWWSQKRIYV GRGMHESQIA LFKYTLFWIL LLCCKLSFSY FVQIKPLIKP TKDIMSVHNI    720
HYEWHEFFPN ASYNIGAILS LWSPVLLVYL MDTQIWYAMF STISGGMSGA LGRLGEVSPN    780
KRTEAAKFAQ LWNEVICSFR EEDFISDKEM DLLVVPYSSD PSLKLMQWPL FLLASKIPIA    840
LDMAAQFRPR DSDLWKRICA DEYMKCAVLE CYESFKLVLN LVVVGENEKR IIGIIIKEIE    900
ANIAKNTFLA NFRMSALPVL CKKFVELVST LKERDSLKFD NVVLLLQDML EVITRDMMVN    960
EIKELAEFGH GNKDLVPRRQ LFAGTGTKPA IVFPPPISAQ WEEQIKRLYL LLTVKESAMD    1020
VPTNLEARRR ISFFTNSLFM EMPRAPRVRK MLSFSVMTPY YSEETVYSRS DLDLENEDGV    1080
SIIFYLQKIF PDEWNNFMER INCKRESEVW GNEENVLQLR HWASLRGQTL CRTVRGMMYY    1140
RKALKLQAFL DMASESEILE GYKAVADPAE EEKKSQRSLS SQLEAIADMK FTYVATCQIY    1200
GNQKQSGDRH ATDILNLMVN YPGLRVAYID EVEERDGDKV QKVFYSVLVK ALDNHDQEIY    1260
RIKLPGPAKI GEGKPENQNH AIIFTRGEAL QTIDMNQDNY LEEALKMRNL LEEFNESHGV    1320
RPPTILGVRE HIFTGSVSSL AWFMSNQETS FVTIGQRVLA NPLKVRFHYG HPDVFDRIFH    1380
ITRGGISKAS CGINLSEDIF AGFNSTLRRG NVTHHEYIQV GKGRDVGLNQ ISLFEAKVAC    1440
GNGEQVLSRD IYRLGHRFDF FRMLSCYFTT VGFYVSSMMV VIIVYVFLYG RLYLALSGLE    1500
FAIMKQARMR GNRALQAAMG SQSIVQLGLL MALPMFMEIG LERGFRSALG DFIIMQLQLC    1560
SVFFTFSLGT KSHYFGRTIL HGGAKYRATG RGFVVRHVKF AENYRMYSRS HFVKGLELLL    1620
LLVVYQIYGD VATDSIAYIL LTSSMWFLVI TWLFAPFLFN PSGFEWQKVV DDWDDWNKWI    1680
SSRGGIGVPA NKAWESWWEE EQEHLLSTGL VGRICEIILS FRFFMFQYGI MYHLNISNGN    1740
KSISVYGLSW LVIVAVVLVL KVVSMGRKKF SADFQLMFRL LKLFLFIGSV GTLAILFTLL    1800
HLTVGDIFAS FLAFAPTGWA ILQISMASKP VVKAFGLWGS VKALSRGYEY LMGIVIFVPV    1860
AVLAWFPFVS EFQTRLLFNQ AFSRGLQISR ILAGGKKQN*                          1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6058.0e-1360173119+
pfam14288FKS1_dom13.0e-45357458103+
pfam02364Glucan_synthase010211741805+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK49452.201189811930AF304372_1 putative beta-1,3-glucan synthase [Nicotiana alata]
DDBJBAD72533.101189911910putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group]
EMBLCAN80181.1030189821932hypothetical protein [Vitis vinifera]
RefSeqNP_849953.2016189821922CALS5 (CALLOSE SYNTHASE 5); 1,3-beta-glucan synthase [Arabidopsis thaliana]
RefSeqXP_002274337.10301898101917PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lxm_A0.0016017316128B Chain B, Lip5-chmp5
PDB2lxl_A0.0026017316128A Chain A, Lip5(mit)2
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
506523
535557
577599
620642
680702
735757
14671489
15151537
15521569
16361658
17431765
17781800
18041826
18471869
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780496339133016680
HO780496184167718590
HO780496133121113290
HO425519627127618970
HO780746520104615560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi2g50140.1Bradi3g60790.2
Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1Bradi2g40460.1
Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)