y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g57017.1
FamilyGH51
Protein PropertiesLength: 661 Molecular Weight: 73344.5 Isoelectric Point: 4.9219
ChromosomeChromosome/Scaffold: 1 Start: 55700783 End: 55706823
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512226500
  VIWFDQVSLMPSGTYKGHGFRKELVHMLLDLRPQFLRFPGGCFVEGNQTKNAFRWRESIGPWEERPGHYGDVWKYWTDDGLGYYEFLQLAEDLGAAPIWV
  FNAGISHTDAVDTSVIAPFVRDALDSIEFARGSAKSTWGSVRASMGHPERFPLKYVTVGNEDCDKINYKGNYLKFYNAIREAYPDIQIISNCDGSSRPLD
  HPADLYDFHVYTNPNDLFLSKDKFRRTSRSGPKVFVSEYAVNVDAGNGNLLASLAESAFLIGLEENSDVVQMASYASLFANDNDRNWNPDAIVFNSWQQY
  GTPSYWIQTIFRESSGAVIHPVRLSSSYSGSLAASAITWQDNEHTFLRVKIVNIGSNTLNLTIDVAGLQAGVDRKRSAITVLTSNNPSDENSFSDPNKVV
  PVKKDLPNAAEEMQVSLVPHSLTSFDLAL
Full Sequence
Protein Sequence     Length: 661     Download
MMGTKDAATV LCSLLLLLSL SCEYSQAAES DYLQAQNTAL LEVDASWKVA RKIPQTLFGL    60
FFEEINHAGA GGIWAELVSN REIYSIGFEA GGQNTPSNID PWSIIGDESS IYVTTERASR    120
FSKNIIALRM EVLCDHCPGG SVGIYNPGFW GMNIEEGKAY NLVMHIRSLE HVEMTASLTC    180
YDGSQNIAST SIVYWLKIEL QLVAQGTCRT SRLELTTSKR GVIWFDQVSL MPSGTYKGHG    240
FRKELVHMLL DLRPQFLRFP GGCFVEGNQT KNAFRWRESI GPWEERPGHY GDVWKYWTDD    300
GLGYYEFLQL AEDLGAAPIW VFNAGISHTD AVDTSVIAPF VRDALDSIEF ARGSAKSTWG    360
SVRASMGHPE RFPLKYVTVG NEDCDKINYK GNYLKFYNAI REAYPDIQII SNCDGSSRPL    420
DHPADLYDFH VYTNPNDLFL SKDKFRRTSR SGPKVFVSEY AVNVDAGNGN LLASLAESAF    480
LIGLEENSDV VQMASYASLF ANDNDRNWNP DAIVFNSWQQ YGTPSYWIQT IFRESSGAVI    540
HPVRLSSSYS GSLAASAITW QDNEHTFLRV KIVNIGSNTL NLTIDVAGLQ AGVDRKRSAI    600
TVLTSNNPSD ENSFSDPNKV VPVKKDLPNA AEEMQVSLVP HSLTSFDLAL DQYGKLVADM    660
*                                                                    720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA0.00156264283+
COG3534AbfA6.0e-26240382143+
pfam06964Alpha-L-AF_C3.0e-34458642201+
smart00813Alpha-L-AF_C1.0e-47458642198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC67598.103266030658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
GenBankEEC67602.10386604628hypothetical protein OsI_34972 [Oryza sativa Indica Group]
RefSeqNP_001065660.103266030658Os11g0131900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001065664.1096609657Os11g0132600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001066062.103266032660Os12g0128700 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ug5_F6e-1724065168504A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
PDB3ug5_E6e-1724065168504A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
PDB3ug5_D6e-1724065168504A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
PDB3ug5_C6e-1724065168504A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
PDB3ug5_B6e-1724065168504A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0462043482255710
HO8526834152406500
GO801860329984210
GT0486153482856300
GT036166336303600
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi4g26270.2Bradi1g17257.1
Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)