y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g62007.1
FamilyGH89
Protein PropertiesLength: 810 Molecular Weight: 91591.3 Isoelectric Point: 7.489
ChromosomeChromosome/Scaffold: 1 Start: 61301294 End: 61318141
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH891028050
  AEIMIQGTTAVELASGLHWYLKYWCGVHISWDKTGGAQLASVPSPGSLPRVNGTGVKIKRPVPWNYYQNVVTSSYSFVWWDWRRWEKEIDWMALQGINLP
  LAFTGQEAVWQKVFKSFNVSDRDLDDFFGGPAFLAWARMGNLHAWGGPLSQNWLDGQLALQKKILSRMTELGMVPVLPSFSGNVPVAFKKLFPSANITRL
  GEWNTVDGDPRWCCTYILDPSDALFIDVGHAFIRQQIKEYGDITSIYNCDTFNENTPPTNEPAYISSLGSAIYEAMSSGNKDAVWLMQGWLFYSDAAFWK
  EPQMKALLHSVPIGKMIVLDLFADVKPVWKMSSQFYGVPYIWCMLHNFGGNIEMYGILDSISSGPIDARTSYGSTMVGVGMTMEGIEHNPVVFELMSEMS
  FRSQKVEVEDWLKSYSYRRYGQSNVKIEKAWGVLYHTIYNCTDGIADHNRDYIVEFPDMSPSSFSSHFSKQRGMPIVRKHPRFFLSEVSANLPHPHLWYS
  TNEAVKALELFLNAGNDLSKSLTFRYDLVDLTRQSLSKLANKVYLDAMDSYKNKNSSGLNFHTKKFLELIVDIDILLASDDNFLLGPWLESAKSLAMSEE
  ERKQYEWNARTQVTMWYDNTKTEQSHLHDYANKFWSGLLKNYYLPRASKYFTGLSRSLQENRSFQLEEWRRDWISYSNEWQSGEELYPVKAKGDALAISK
  SLFR
Full Sequence
Protein Sequence     Length: 810     Download
MRPPPPPSLA LLPFVLLLVL IPLPPAAATA AGHTWREALR TAAGRRAASP AVQEGAAAGV    60
LHRLLPSHAH SFRFQIDTKG GVCGESSCFR ISNVDGSGRG GAEIMIQGTT AVELASGLHW    120
YLKYWCGVHI SWDKTGGAQL ASVPSPGSLP RVNGTGVKIK RPVPWNYYQN VVTSSYSFVW    180
WDWRRWEKEI DWMALQGINL PLAFTGQEAV WQKVFKSFNV SDRDLDDFFG GPAFLAWARM    240
GNLHAWGGPL SQNWLDGQLA LQKKILSRMT ELGMVPVLPS FSGNVPVAFK KLFPSANITR    300
LGEWNTVDGD PRWCCTYILD PSDALFIDVG HAFIRQQIKE YGDITSIYNC DTFNENTPPT    360
NEPAYISSLG SAIYEAMSSG NKDAVWLMQG WLFYSDAAFW KEPQMKALLH SVPIGKMIVL    420
DLFADVKPVW KMSSQFYGVP YIWCMLHNFG GNIEMYGILD SISSGPIDAR TSYGSTMVGV    480
GMTMEGIEHN PVVFELMSEM SFRSQKVEVE DWLKSYSYRR YGQSNVKIEK AWGVLYHTIY    540
NCTDGIADHN RDYIVEFPDM SPSSFSSHFS KQRGMPIVRK HPRFFLSEVS ANLPHPHLWY    600
STNEAVKALE LFLNAGNDLS KSLTFRYDLV DLTRQSLSKL ANKVYLDAMD SYKNKNSSGL    660
NFHTKKFLEL IVDIDILLAS DDNFLLGPWL ESAKSLAMSE EERKQYEWNA RTQVTMWYDN    720
TKTEQSHLHD YANKFWSGLL KNYYLPRASK YFTGLSRSLQ ENRSFQLEEW RRDWISYSNE    780
WQSGEELYPV KAKGDALAIS KSLFRKYLS*                                     840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N3.0e-2353152100+
pfam12972NAGLU_C7.0e-98511807297+
pfam05089NAGLU0167506340+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24942.10780962868unnamed protein product [Vitis vinifera]
GenBankEEC75285.104780850811hypothetical protein OsI_11626 [Oryza sativa Indica Group]
GenBankEEE59081.104780950812hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
RefSeqXP_002273084.10178098803PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002465249.103880941776hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A097798207867A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2vcb_A097798207867A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2vca_A097798207867A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2vc9_A097798207867A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A097798230890A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH1897493753296990
HO7834553213126300
HO7834551556327860
CB632336273953670
CB6447852631153770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)