y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g63540.1
FamilyGT57
Protein PropertiesLength: 519 Molecular Weight: 58839.4 Isoelectric Point: 9.6195
ChromosomeChromosome/Scaffold: 1 Start: 62686410 End: 62689156
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57404970
  LLVRVLVSVGPYSGQGAAPKFGDYEAQRHWMELTLHLPTSDWYRNTSDNDLAYWGLDYPPLSAYQSLLHARLINASLPDTVALRSSRGFESPESKLLMRW
  TVLSSDLMVFFPAALWFVWAYMKDGVGGGGEKREGWMWLLAMVLINPCLVLIDHGHFQYNCISLGLTLGAIAGVLSRNELAAAALFSLAINHKQMSMYFA
  PAFFGHLLGKCLKRKYPILEVTKLGFVVFGTFALVWWPYLRSYQATMQVISRLAPFERGIYEDYVANFWCSTSVLIKWKRLFAIKPLKLMSLCATIFAFL
  PSFVQQVKSPSNLGFLYSLLNSSFSFYLFSYQVHEKSILLPLLPASLLALHEPHLYGWFTYYALFSMYPLICRDQLLLQYIAVLGLFFLIYYSPGASYVK
  GINVSSGTKAVLSLPLLCSILFHIVYLQIEPPKRYPFLFDALIMFICFSQFVILTLYT
Full Sequence
Protein Sequence     Length: 519     Download
MAKPRKSRNP ASDLPAPARL PWQPPAQPVA TALLISLAAL LVRVLVSVGP YSGQGAAPKF    60
GDYEAQRHWM ELTLHLPTSD WYRNTSDNDL AYWGLDYPPL SAYQSLLHAR LINASLPDTV    120
ALRSSRGFES PESKLLMRWT VLSSDLMVFF PAALWFVWAY MKDGVGGGGE KREGWMWLLA    180
MVLINPCLVL IDHGHFQYNC ISLGLTLGAI AGVLSRNELA AAALFSLAIN HKQMSMYFAP    240
AFFGHLLGKC LKRKYPILEV TKLGFVVFGT FALVWWPYLR SYQATMQVIS RLAPFERGIY    300
EDYVANFWCS TSVLIKWKRL FAIKPLKLMS LCATIFAFLP SFVQQVKSPS NLGFLYSLLN    360
SSFSFYLFSY QVHEKSILLP LLPASLLALH EPHLYGWFTY YALFSMYPLI CRDQLLLQYI    420
AVLGLFFLIY YSPGASYVKG INVSSGTKAV LSLPLLCSIL FHIVYLQIEP PKRYPFLFDA    480
LIMFICFSQF VILTLYTNYK QWMLDLHPRP VGRRKKDL*                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg84.0e-10049499466+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC79743.1015181517putative alpha 3 glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_001058960.101472109569Os07g0164500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001145139.1015181519hypothetical protein LOC100278369 [Zea mays]
RefSeqXP_002280181.103051631514PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.104351815490predicted protein [Populus trichocarpa]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5470EC-2.4.1.267Dol-P-Glc:Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
140159
174191
198215
257279
320342
352370
377399
414436
449466
476498
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ6748672671854510
CJ6276752431353770
JG8643202891344210
FF5813522642565190
FF5813502491754230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny