y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g66940.1
FamilyGT4
Protein PropertiesLength: 465 Molecular Weight: 53268 Isoelectric Point: 8.6927
ChromosomeChromosome/Scaffold: 1 Start: 65694538 End: 65697502
Descriptiondigalactosyl diacylglycerol deficient 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42323333.5e-21
  YYIGKMVWSKGYTELLQLFHKHQKELSGLKMELYGSGEDADEVKASAEKLNLDVRVYPGRDHADSIFHDYKVFINPSTTDVVCTTTAEALAMGKIVICAN
  HP
Full Sequence
Protein Sequence     Length: 465     Download
MARRQHVTIV TTASLPWMTG TAVNPLFRAA YLAKTGDWEV TLVVPWLSKA DQMLVYPNKM    60
KFGAPGEQEA YVRRWLEERI GALPRFNINF YPGKFSTEKR SILPVGDITE TVSDAKADIA    120
VLEEPEHLTW YHHGRRWKTK FRKVIGVVHT NYLEYVKRER NGYIHAFLLK HINSWVTDIY    180
CHKVIRLSGA TQDVPRSVIC NVHGVNPKFI EIGKLKQRQI SQREQSFFKG AYYIGKMVWS    240
KGYTELLQLF HKHQKELSGL KMELYGSGED ADEVKASAEK LNLDVRVYPG RDHADSIFHD    300
YKVFINPSTT DVVCTTTAEA LAMGKIVICA NHPSNEFFKR FPNCHMYNTE KEFVKLTMKA    360
LAEEPITLSE ELRHELSWEA ATERFVRVAD IAPAMPIKQN PSSSQHFMYI NPDELKKNME    420
DASAFFHNTI SGIEAARWVF GAIPNSLQPD EQQCKELGWR PQGQ*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG6.0e-9133334223+
COG0438RfaG8.0e-126388398+
pfam00534Glycos_transf_15.0e-12233384159+
PLN02846PLN0284601463463+
PLN02501PLN0250104461463+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28066.1014631464unknown [Zea mays]
GenBankEAZ26389.1014621422hypothetical protein OsJ_10273 [Oryza sativa Japonica Group]
RefSeqNP_001049672.1014621462Os03g0268300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001144526.1014171418hypothetical protein LOC100277520 [Zea mays]
RefSeqXP_002465496.1014631464hypothetical protein SORBIDRAFT_01g039910 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2l7c_A0.001225243119A Chain A, Biophysical Studies Of Lipid Interacting Regions Of Dgd2 In Arabidopsis Thaliana
Metabolic Pathways
Pathway NameReactionECProtein Name
cornusiin E biosynthesisRXN-8719EC-1.10.3pentagalloylglucose: O2 oxidoreductase
glycolipid biosynthesisRXN-1225EC-2.4.1.241digalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX109154413504620
GO8836223311324620
CK16349630913090
GO8521973181454610
CX109154451456e-16
Orthologous Group
SpeciesID
Arabidopsis lyrata897369490510
Arabidopsis thalianaAT4G00550.1AT3G11670.1
Brassica rapaBra034821
Glycine maxGlyma19g38720.1
Gossypium raimondiiGorai.002G235100.1
Manihot esculentacassava4.1_001948mcassava4.1_004529m
Mimulus guttatusmgv1a001509m
Panicum virgatumPavirv00006441m
Populus trichocarpaPotri.016G070200.2Potri.016G070200.1Potri.006G203200.4Potri.006G203200.3
Setaria italicaSi026023mSi026022m
Sorghum bicolorSb05g003730.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny