y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g67467.1
FamilyGT29
Protein PropertiesLength: 479 Molecular Weight: 53754.5 Isoelectric Point: 8.4536
ChromosomeChromosome/Scaffold: 1 Start: 66139565 End: 66143571
DescriptionMALE GAMETOPHYTE DEFECTIVE 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291613551.49995e-41
  CYNRTLCEELLSVLLPAKPPFHPRQFATCAVVGNSGDLLKTEFGREIDAHDAVFRDNEAPVNKKYAKYVGLKRDFRLVVRGAARNMAPILNGSSDEALII
  KSLTHKEINAVIKELPNPVYLFQGIVLRRGAKGTGMKSIELALSMCDIVDVYGFTVDPGYTEWTRYFSAPRKGHNPLQGRAYYQLLECLGVVRLH
Full Sequence
Protein Sequence     Length: 479     Download
MSRASSTPQQ PPPPHRPTVA LLLGLALVFC LSVLSIQSSF TAPRVPSRLE VDAEQVRELS    60
GFQSRVQQCV ASRGLGLTAD IVDHCKLVLK FPTGTNSTWY NAQFKIFEPL EYRYDVCETI    120
LLWEQYRNVT TVLTREYLDV RPDGWLDYAA KRIAQLGAKK CYNRTLCEEL LSVLLPAKPP    180
FHPRQFATCA VVGNSGDLLK TEFGREIDAH DAVFRDNEAP VNKKYAKYVG LKRDFRLVVR    240
GAARNMAPIL NGSSDEALII KSLTHKEINA VIKELPNPVY LFQGIVLRRG AKGTGMKSIE    300
LALSMCDIVD VYGFTVDPGY TEWTRYFSAP RKGHNPLQGR AYYQLLECLG VVRLHSPMRA    360
QRVEDWSDVP SKEEIKRAHA AAFRLKKHEI GQADELGPFS NCKVWGTVDP DYGPVSGTSD    420
MSETRRNSNY SKWELLPLEK LRNEAQEHHA QMGGVSLYKM DGNKLDDLVC VRHEHSSG*     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_296.0e-48146358264+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF82979.103847736476unknown [Zea mays]
EMBLCAJ44462.103847740480sialyltransferase like protein [Sorghum bicolor]
RefSeqNP_001068125.103847740479Os11g0572400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105844.103847736476sialyltransferase like protein [Zea mays]
RefSeqXP_002449728.103847740480hypothetical protein SORBIDRAFT_05g022210 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000003189339100266A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB2wnb_A0.0000000003189339100266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000003189339100266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
1941
Signal Peptide
Cleavage Site
35
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR9147972981144110
JG9156812691614290
EG3884982521904410
CK254085301353340
EY7151712901834710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)