y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g69490.1
FamilyCE11
Protein PropertiesLength: 320 Molecular Weight: 34286.9 Isoelectric Point: 6.3972
ChromosomeChromosome/Scaffold: 1 Start: 67992663 End: 67999614
DescriptionUDP-3-O-acyl N-acetylglycosamine deacetylase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11253070
  QQTLAAAVSRSGVGLHSGARATATLLPTRAGEGRYFVVEGEETRVAAEVGNAETQSPLCTTLRSGGGAARVRTVEHLLSAMEALGVDNCRVEVSGSDEVP
  LLDGSAQEWVEAIRSAGLCVAEDISGEKLEKMAPKIDEPVYLRKDDCFVSAFPSSQIHITYGIDFPKAPAIGCQWFTTFLDANIYSSKIAPARTFCIFEE
  VEKMRSAGLIKGGSLESAMVCSMTRGWLNPPLRFEDEPCRHKVLDLIGDFSLLAQNGNQGFPIAHVVAYKAGHALHTNFLRQL
Full Sequence
Protein Sequence     Length: 320     Download
MTAAARGLQS VSRAAFSWQP TGRAQQTLAA AVSRSGVGLH SGARATATLL PTRAGEGRYF    60
VVEGEETRVA AEVGNAETQS PLCTTLRSGG GAARVRTVEH LLSAMEALGV DNCRVEVSGS    120
DEVPLLDGSA QEWVEAIRSA GLCVAEDISG EKLEKMAPKI DEPVYLRKDD CFVSAFPSSQ    180
IHITYGIDFP KAPAIGCQWF TTFLDANIYS SKIAPARTFC IFEEVEKMRS AGLIKGGSLE    240
SAMVCSMTRG WLNPPLRFED EPCRHKVLDL IGDFSLLAQN GNQGFPIAHV VAYKAGHALH    300
TNFLRQLSGR ITADQEKLA*                                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131881.0e-6225319329+
TIGR00325lpxC1.0e-7325316295+
COG0774LpxC2.0e-8623316310+
pfam03331LpxC1.0e-8625316295+
PRK13186lpxC3.0e-10425307287+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN52736.1033194312Hypothetical protein [Oryza sativa Japonica Group]
GenBankABF94722.1032814280UDP-3-0-acyl N-acetylglucosamine deacetylase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEE58623.1033194319hypothetical protein OsJ_09977 [Oryza sativa Japonica Group]
RefSeqNP_001049426.1033194318Os03g0223900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002468246.1023193322hypothetical protein SORBIDRAFT_01g042410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xxe_A1e-38253104266A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB4fw7_D3e-38253077277A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB4fw7_C3e-38253077277A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB4fw7_B3e-38253077277A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
PDB4fw7_A3e-38253077277A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisUDPACYLGLCNACDEACETYL-RXNEC-3.5.1.108UDP-3-O-acyl-N-acetylglucosamine deacetylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HX13680525862630
CK20717724862530
CT85007229432960
CA2465592011193190
HX1368281811403200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24793.1AT1G24880.1
AT1G25054.2AT1G25145.1AT1G25210.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Glycine maxGlyma02g09350.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.3Gorai.002G172000.1Gorai.002G172000.2
Gorai.002G172000.6Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1
Gorai.009G391300.3Gorai.009G391300.2Gorai.009G391300.1Gorai.007G245600.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Sorghum bicolorSb01g042410.1
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny