y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g71040.1
FamilyCBM22
Protein PropertiesLength: 580 Molecular Weight: 64254.3 Isoelectric Point: 6.99
ChromosomeChromosome/Scaffold: 1 Start: 69161886 End: 69166244
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22541723.7e-21
  LIVNPDFNAGLQGWSVFGYGSVGEATSAATGNRYAVARNRTRPYQSVSQKVYLQNDTHYTLSAWLQVSDGSADVIAVVKTAGGGFVHSGGVDARSGCWSI
  LKGGLTAAASGPAELYFES
GH102324940
  RNGFPLGAAMSQEILRNQAYQSWFTKRFTVTTFENEMKWYSTEQAQGREDYSVPDAMVRFARGHGIKVRGHNIFWDDPGTQPGWVRNLSPDQLRRAADRR
  IKSVMSRYAGKVIAWDVVNENVHFDFYEGKFGWQASPAFYRKAHQIDGGALMSMNDYNTLEQPGDTNCLPSKYLRKLWQIKGFPGNGNAARMAIGLEGHF
  SAEPNIPYVRAALDAMAQANVPIWVTEIDVQPGPNQAWHLEQVMREVYSHPAVHGIVLWTAWH
Full Sequence
Protein Sequence     Length: 580     Download
MRALTMEKPA AVFLLVWAAA LLNAALMVQS IPYDYSSSSE CLAEPLEPHY GGGLIVNPDF    60
NAGLQGWSVF GYGSVGEATS AATGNRYAVA RNRTRPYQSV SQKVYLQNDT HYTLSAWLQV    120
SDGSADVIAV VKTAGGGFVH SGGVDARSGC WSILKGGLTA AASGPAELYF ESNATVDIWV    180
DNVSLQPFSR EEWHAHRVDA TKKARKKTVR LRARDNAGQP LPGARMHVEH IRNGFPLGAA    240
MSQEILRNQA YQSWFTKRFT VTTFENEMKW YSTEQAQGRE DYSVPDAMVR FARGHGIKVR    300
GHNIFWDDPG TQPGWVRNLS PDQLRRAADR RIKSVMSRYA GKVIAWDVVN ENVHFDFYEG    360
KFGWQASPAF YRKAHQIDGG ALMSMNDYNT LEQPGDTNCL PSKYLRKLWQ IKGFPGNGNA    420
ARMAIGLEGH FSAEPNIPYV RAALDAMAQA NVPIWVTEID VQPGPNQAWH LEQVMREVYS    480
HPAVHGIVLW TAWHPQGCYV MCLTDNGFRN LPVGDVVDKL IGEWKTHSHV GVADAEGYYE    540
AELFHGEYKV TVAHPAANST AVQSLMVDKE SDNEYTIHV*                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_95.0e-752172129+
COG3693XynA2.0e-30257461215+
pfam00331Glyco_hydro_106.0e-49229490286+
smart00633Glyco_104.0e-69268517273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF94510.10857945791,4-beta-xylanase, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEC74705.1085794579hypothetical protein OsI_10421 [Oryza sativa Indica Group]
GenBankEEE58525.1085794579hypothetical protein OsJ_09814 [Oryza sativa Japonica Group]
GenBankEEE58525.1027467561986hypothetical protein OsJ_09814 [Oryza sativa Japonica Group]
RefSeqXP_002465685.101057914584hypothetical protein SORBIDRAFT_01g043720 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nq6_A2e-3023751715298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1e0v_A1e-2323252211302A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
PDB1v0n_A2e-2323252211302A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
PDB1v0m_A2e-2323252211302A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
PDB1v0l_A2e-2323252211302A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Transmembrane Domains
StartEnd
1231
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL8705672613235800
EG384751245833270
FL9146122631934550
FL8546872513235730
FL913878249402870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00218.1.27.143Aquca_011_00219.1.49.165
Arabidopsis lyrata913024.46.162491295.46.161
Arabidopsis thalianaAT4G33840.1.46.161AT4G33830.1.47.162AT4G33860.1.46.161
Brachypodium distachyonBradi1g71040.1.54.172
Brassica rapaBra034585.47.155Bra034584.46.161Bra017609.141.256
Carica papayaevm.model.supercontig_106.45.53.168
Capsella rubellaCarubv10006586m.46.161
Citrus clementinaCiclev10030382m.52.167
Fragaria vescamrna28152.1-v1.0-hybrid.50.168
Glycine maxGlyma11g11200.1.73.188Glyma11g11220.1.35.152
Linum usitatissimumLus10020985.24.142Lus10033786.35.153Lus10014642.40.158
Malus domesticaMDP0000245498.55.170
Manihot esculentacassava4.1_021918m.41.156
Mimulus guttatusmgv1a003597m.49.165
Oryza sativaLOC_Os03g10478.1.55.172LOC_Os03g10440.1.51.167
Panicum virgatumPavirv00027101m.14.130Pavirv00026745m.37.153
Phaseolus vulgarisPhvul.011G033100.1.41.156
Picea abiesMA_429144g0010.58.183MA_10434167g0010MA_7941351g0010
Populus trichocarpaPotri.009G087900.1.27.142
Prunus persicappa021363m.43.158
Ricinus communis29812.m000195.44.159
Setaria italicaSi034867m.54.170Si034912m.47.163
Selaginella moellendorffii420481.76.197
Thellungiella halophilaThhalv10024995m.45.160Thhalv10027468m.47.162
Vitis viniferaGSVIVT01037833001.70.185GSVIVT01037825001.23.138
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny