y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g71050.1
FamilyGH10
Protein PropertiesLength: 502 Molecular Weight: 56131.6 Isoelectric Point: 6.3773
ChromosomeChromosome/Scaffold: 1 Start: 69168374 End: 69170305
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH102444141e-33
  SLKEAMAKRMKSVVSRYAGKLIHWDVVNENLHFSFFEDKLGKDASGEVFKEVAKLDDKPILFMNEYNTIEEPNDGAPLPTKYLAKLKQIQSYPGNSKLKY
  GIGLESHFAIPNIPYVRGSLDTLAQAKVPIWLTEIDVIKGPKQVEYLEELMREGFAHPGVKGIVLWAAWHA
Full Sequence
Protein Sequence     Length: 502     Download
MQCEKEPPKP LYGGGILTDA EAPAPVATGG KKLLMAKTTS APVKGSTLKF ELEKDTHYAL    60
SAWLQFSKST GDVRAVLVTP DGKFNTAGMI VVQSGCWTML KGGATSFSAG KGELFFETNV    120
TAELMADSMA LQPFTFEEWK LHRDESITKE RKKKVKITVQ GSDGKELPDA ELSLERVAKG    180
FPLGNAMTKE ILDMPEYEKW FTSRFTVATM ENEMKWDSTE YDKGHELYEI PDKMLALAEK    240
YKISLKEAMA KRMKSVVSRY AGKLIHWDVV NENLHFSFFE DKLGKDASGE VFKEVAKLDD    300
KPILFMNEYN TIEEPNDGAP LPTKYLAKLK QIQSYPGNSK LKYGIGLESH FAIPNIPYVR    360
GSLDTLAQAK VPIWLTEIDV IKGPKQVEYL EELMREGFAH PGVKGIVLWA AWHAKGCYVM    420
CLTDNKFKNL PVGDVVDKLI AEWKDVPKDA KTDDKGVFEA ELFHGEYNVT VKHKSLKELF    480
METVDLDSKS EATIKAKGKE Y*                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3693XynA5.0e-21184409271+
pfam00331Glyco_hydro_102.0e-32173409284+
smart00633Glyco_101.0e-53214436270+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF94508.10150135557Glycosyl hydrolase family 10 protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABF94509.1024979526Glycosyl hydrolase family 10 protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEC74704.10150135557hypothetical protein OsI_10420 [Oryza sativa Indica Group]
RefSeqNP_001049300.10149735553Os03g0201800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002465686.10149667572hypothetical protein SORBIDRAFT_01g043730 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ta3_B0.0000000000000818340917268B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1nq6_A0.0000000000000818343615298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1xyz_B0.000000000000317841034306A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1xyz_A0.000000000000317841034306A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1tux_A0.000000000000420544040301A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL7884872242454680
FL8444592411003150
EX5765532122554660
FL7856871793194960
AW3998521912454350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.4.344.628Aquca_017_00095.3.344.628Aquca_017_00095.2.564.848Aquca_017_00095.1.577.861Aquca_006_00211.1
Aquca_003_00413.1Aquca_011_00218.1.200.461Aquca_011_00219.1.223.486Aquca_006_00211.2
Arabidopsis lyrata475392.571.844489729.403.684490628913024.223.481491296
491295.221.480353449353450480358
Arabidopsis thalianaAT1G58370.1.570.844AT4G08160.1.404.685AT4G08160.2.404.657AT4G38650.1AT4G38300.1
AT4G33830.1.222.485AT4G33840.1.222.480AT4G33860.1.222.480AT4G33820.1AT4G33810.1
AT2G14690.1
Brachypodium distachyonBradi1g12710.1.410.670Bradi2g02320.1.243.531Bradi2g02330.1Bradi1g27257.1.195.481Bradi5g04640.1
Bradi1g68310.1Bradi3g24410.1Bradi1g71040.1.232.494Bradi1g71076.1
Brassica rapaBra031698.712.996Bra027867.572.849Bra039768.635.918Bra010733Bra017609.315.575
Bra034585.221.481Bra034584.220.481Bra034586Bra036392Bra017610
Carica papayaevm.model.supercontig_160.18.423.706evm.model.supercontig_160.19.570.841evm.model.supercontig_37.165evm.model.supercontig_106.45.230.491evm.model.supercontig_169.45
evm.model.supercontig_106.44
Capsella rubellaCarubv10008217m.613.898Carubv10019737m.593.868Carubv10000293m.404.688Carubv10004489mCarubv10004963m
Carubv10006586m.221.480Carubv10006745mCarubv10004408mCarubv10015996m
Citrus clementinaCiclev10000171m.611.880Ciclev10030219mCiclev10028121mCiclev10030382m.227.489Ciclev10028089m
Citrus sinensisorange1.1g002447m.574.843orange1.1g036715morange1.1g035723morange1.1g042396morange1.1g008838m
Cucumis sativusCucsa.353160.7.566.835Cucsa.353160.4.599.868Cucsa.353160.1.599.868Cucsa.353160.8.341.611Cucsa.143690.1.601.869
Cucsa.169000.1Cucsa.219120.1Cucsa.298380.1
Eucalyptus grandisEucgr.F00109.1.537.816Eucgr.F00108.3.544.819Eucgr.F00108.2.583.858Eucgr.F00108.1.587.862Eucgr.F02205.1.452.713
Eucgr.I01059.1Eucgr.G01773.1Eucgr.I01060.1Eucgr.I01061.1Eucgr.G01210.1
Eucgr.G01205.1Eucgr.G01215.1Eucgr.G01214.1Eucgr.G01217.1Eucgr.G01206.1
Eucgr.G01213.1Eucgr.G01209.1
Fragaria vescamrna02649.1-v1.0-hybrid.593.860mrna07626.1-v1.0-hybridmrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976
mrna28152.1-v1.0-hybrid.228.491mrna25508.1-v1.0-hybrid.175.436mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484
Glycine maxGlyma14g10456.2.555.825Glyma14g10456.1.584.854Glyma06g05290.1.396.666Glyma04g05220.3.395.665Glyma04g05220.2.395.665
Glyma17g35060.2.585.853Glyma17g35060.1.556.824Glyma06g00680.1Glyma04g00610.2Glyma04g00610.1
Glyma11g11220.1.211.472Glyma11g11200.1.222.493Glyma20g27040.1Glyma10g40300.2Glyma10g40300.1
Glyma10g40293.1
Gossypium raimondiiGorai.009G223500.6.425.707Gorai.009G223500.5.565.847Gorai.009G223500.4.564.846Gorai.009G223500.3.565.847Gorai.009G223500.2.564.846
Gorai.009G223500.1.565.847Gorai.009G223600.1.421.696Gorai.010G029100.1.585.855Gorai.005G231200.1Gorai.008G020100.2
Gorai.008G020100.1Gorai.005G231100.2Gorai.005G231100.1Gorai.002G195600.1.359.528Gorai.002G195600.1.359.528
Gorai.002G195600.1.359.528Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.280.355
Gorai.002G195600.1.280.355Gorai.002G195600.1.280.355
Linum usitatissimumLus10007242.429.712Lus10028242.428.711Lus10025054Lus10033786.213.477Lus10014642.218.482
Lus10020985.202.471Lus10033784Lus10034490Lus10014646
Malus domesticaMDP0000225641.598.870MDP0000246856MDP0000249571MDP0000245498.229.493MDP0000144523
MDP0000779011MDP0000146624.768.905MDP0000146624.768.905MDP0000132261MDP0000146624.669.763
MDP0000146624.669.763
Manihot esculentacassava4.1_002200m.411.692cassava4.1_001250m.571.847cassava4.1_001252m.573.850cassava4.1_001320m.557.841cassava4.1_033386m
cassava4.1_029937mcassava4.1_021918m.217.482cassava4.1_021990mcassava4.1_028847mcassava4.1_026436m
Medicago truncatulaMedtr3g117800.1Medtr7g024420.1Medtr1g106800.1Medtr1g106790.1Medtr1g106910.1
Medtr1g106770.1
Mimulus guttatusmgv1a027071m.549.820mgv1a000981m.578.858mgv1a020606mmgv1a003597m.225.485mgv1a023132m
mgv1a024427mmgv1a003542mmgv1a019481mmgv1a025021mmgv1a022322m
mgv1a004157mmgv1a004760mmgv1a021702mmgv1a004887m
Oryza sativaLOC_Os03g47010.1.411.694LOC_Os01g04300.1.211.499LOC_Os01g04290.1LOC_Os05g25560.1LOC_Os05g23350.1
LOC_Os03g14010.3LOC_Os03g14010.2LOC_Os03g14010.1LOC_Os05g23924.2LOC_Os05g23924.1
LOC_Os03g10469.2LOC_Os03g10469.1LOC_Os10g21110.1LOC_Os03g10440.1.227.490LOC_Os03g10478.1.232.497
LOC_Os10g21100.1
Panicum virgatumPavirv00018091m.408.690Pavirv00043679m.401.686Pavirv00043214mPavirv00009472m.233.513Pavirv00011920m
Pavirv00064836mPavirv00011543mPavirv00004670mPavirv00012621mPavirv00003316m
Pavirv00046655mPavirv00001379mPavirv00041480mPavirv00066390mPavirv00041724m
Pavirv00066756mPavirv00064807mPavirv00011965mPavirv00070694m.721.846Pavirv00049463m
Pavirv00011967mPavirv00011966mPavirv00027101m.191.313Pavirv00026745m.214.317
Physcomitrella patensPp1s121_107V6.1.717.999
Phaseolus vulgarisPhvul.009G075400.1.397.677Phvul.001G032300.2.556.827Phvul.001G032300.1.583.854Phvul.009G120500.1Phvul.011G033100.1.217.499
Phvul.007G045400.1Phvul.007G045500.1Phvul.007G045900.1
Picea abiesMA_9039435g0010.206.470MA_350255g0010MA_604666g0010MA_10433351g0010MA_9354042g0010
MA_429144g0010.244.407MA_8357324g0010
Populus trichocarpaPotri.002G113100.2.412.693Potri.004G173300.4Potri.004G173300.3Potri.004G173300.2Potri.004G173300.1
Potri.009G087900.1.202.466Potri.009G087800.3Potri.009G087800.2Potri.009G087800.1Potri.009G087700.2
Potri.009G087700.1Potri.009G087600.1
Prunus persicappa001089m.567.845ppa004290mppa016947mppa021363m.219.483ppa023031m
ppa024827m
Ricinus communis30170.m013644.481.75830170.m01364629492.m00007029812.m00019629812.m000195.218.483
29812.m00019429812.m00019958888.m000026
Setaria italicaSi038956m.406.689Si000821mSi000630m.297.586Si025026mSi034995m.207.495
Si001255mSi034968mSi039948mSi034867m.230.491Si039549m
Si039641mSi034912m.223.486
Selaginella moellendorffii111304.535.794420481.257.518
Sorghum bicolorSb01g012210.1.405.688Sb03g006980.1.246.530Sb03g006950.1.218.506Sb04g020543.1Sb01g041310.1
Sb06g003350.1Sb01g043760.1Sb02g004490.1Sb01g043730.1Sb01g043720.1
Thellungiella halophilaThhalv10023244m.581.848Thhalv10028466m.388.667Thhalv10024805mThhalv10027468m.221.481Thhalv10024995m.219.458
Thhalv10023172m
Vitis viniferaGSVIVT01009272001.602.834GSVIVT01024049001GSVIVT01037833001.244.520GSVIVT01037833001.244.520GSVIVT01037832001
GSVIVT01037825001.197.461
Volvox carteriVocar20000377mVocar20006952m
Zea maysAC204711.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)