y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g71160.1
FamilyGH43
Protein PropertiesLength: 470 Molecular Weight: 53613.3 Isoelectric Point: 6.6789
ChromosomeChromosome/Scaffold: 1 Start: 69218968 End: 69221918
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431623895.4e-35
  KTETYYWYGENKDGKTYKAHTKGADRVDIVGVSCYSSKDLWAWKNEGVVLRGEVKNVTHDLYKSNVLERPKVIYNDQTSKYVMWMHIDDTNYTKASVGVA
  VSNSPTGPFSYLYSKRPHDCESRDMTIFKDDNGKAYLIYSSEDNSELHIGELTDDYLDVTNDMRSFLIAQHREAPALFKFEGVYYMITSGCTSWAPNTAL
  AHAATSIMGPWETLGNPCVGGNDIFRST
Full Sequence
Protein Sequence     Length: 470     Download
MAMGTRSRHP KSLALRCYAA SHRSLTLLVW SLAALVILLN FHLLTTGTHR EDLSSRAHEI    60
HRSIVRELEE VEEEMFQVKP ARSRRNPRAV RRKGEHSKPH SVVDEFLDES SAVHDMFFPE    120
TAMDPVHGGN DSMYFYHPGR VWLDTDGKPI QAHGGGVLYD EKTETYYWYG ENKDGKTYKA    180
HTKGADRVDI VGVSCYSSKD LWAWKNEGVV LRGEVKNVTH DLYKSNVLER PKVIYNDQTS    240
KYVMWMHIDD TNYTKASVGV AVSNSPTGPF SYLYSKRPHD CESRDMTIFK DDNGKAYLIY    300
SSEDNSELHI GELTDDYLDV TNDMRSFLIA QHREAPALFK FEGVYYMITS GCTSWAPNTA    360
LAHAATSIMG PWETLGNPCV GGNDIFRSTT FFSQSTFVVP LPGLRGSFIF MADRWNPSEL    420
RDSRYVWLPL TVGGLPDEAA DYSFMFPLWP RVSIYWHRRW RLPEGWTDS*               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_23.0e-16231387187+
cd09004GH43_bXyl3.0e-18194377195+
cd08990GH43_AXH_like8.0e-20195373193+
cd08978GH_F3.0e-43164430278+
cd08985GH43_62.0e-120150432284+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC69140.102469352818hypothetical protein OsI_38068 [Oryza sativa Indica Group]
GenBankEEE53089.102469298764hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
RefSeqNP_001066630.1034691466Os12g0406100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151925.1034691467glycosyl hydrolase, family 43 protein [Zea mays]
RefSeqXP_002468324.1034691467hypothetical protein SORBIDRAFT_01g043810 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F013945445346A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3vt2_E013945445346A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3vt2_D013945445346A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3vt2_C013945445346A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3vt2_B013945445346A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Transmembrane Domains
StartEnd
2446
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8017533011704700
GO8561533351324660
JG8646842761844590
JG918498279933690
JG9370722511363860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny