y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi1g72620.1
FamilyGT33
Protein PropertiesLength: 472 Molecular Weight: 52077.2 Isoelectric Point: 6.3239
ChromosomeChromosome/Scaffold: 1 Start: 70317629 End: 70321455
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3384640
  KKRAAVVVLGDIGRSPRMQYHSLSLANQAGMEVDIVANGGSDPHLSLRENPSIHIHEMKSVQLPGISKISGALALLLKAAIQFIMLVWFLCFKIPCPDVF
  IVQNPPSVPTLAAVKLVSWIRGAKFIVDWHNFGYTLLGLSHGRSHIVVKIYFWFEKHFGQMADGAFCVTKAMQHELAQNWGIKATVLYDHSPEFFHPASL
  AEKHELFSRLGNTICSAMGSADCISVEKEGDDKNTTVLTSNIDGEILLKPNRPALVVSSTSWTPDEDFSILLEAALMYDRRVAATLGEEDSMDEGQLWID
  IKNGKQFSYPRLLFIITGKGPDRKKYEEQVKRLKLRRVAFRTMWLASEDYPLLLGSADLGVSLHTSSSGLDLPMKVVDMFGCGLPVCAASFSCIEELVKV
  NINGLLFSTSSELADELMMLFKGFPEECDTLKSLKDGALSTGSSSKWSTEWETYALP
Full Sequence
Protein Sequence     Length: 472     Download
MEVEAGRKKR AAVVVLGDIG RSPRMQYHSL SLANQAGMEV DIVANGGSDP HLSLRENPSI    60
HIHEMKSVQL PGISKISGAL ALLLKAAIQF IMLVWFLCFK IPCPDVFIVQ NPPSVPTLAA    120
VKLVSWIRGA KFIVDWHNFG YTLLGLSHGR SHIVVKIYFW FEKHFGQMAD GAFCVTKAMQ    180
HELAQNWGIK ATVLYDHSPE FFHPASLAEK HELFSRLGNT ICSAMGSADC ISVEKEGDDK    240
NTTVLTSNID GEILLKPNRP ALVVSSTSWT PDEDFSILLE AALMYDRRVA ATLGEEDSMD    300
EGQLWIDIKN GKQFSYPRLL FIITGKGPDR KKYEEQVKRL KLRRVAFRTM WLASEDYPLL    360
LGSADLGVSL HTSSSGLDLP MKVVDMFGCG LPVCAASFSC IEELVKVNIN GLLFSTSSEL    420
ADELMMLFKG FPEECDTLKS LKDGALSTGS SSKWSTEWET YALPLVNQVI G*            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01635Glycosyltransferase_GTB_type8.0e-10316414100+
COG0438RfaG3.0e-1090429347+
TIGR00032argG7.0e-11317425110+
PLN02275PLN0227505428425+
cd03816GT1_ALG1_like08466461+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN65437.1034685451Putative glycosyl transferase [Oryza sativa Japonica Group]
GenBankEEC80822.101647118447hypothetical protein OsI_23401 [Oryza sativa Indica Group]
RefSeqNP_001049165.1034715473Os03g0180700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149006.1054712468beta-1,4-mannosyltransferase [Zea mays]
RefSeqXP_002465752.1074717471hypothetical protein SORBIDRAFT_01g045200 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesis2.4.1.142-RXNEC-2.4.1.142chitobiosyldiphosphodolichol β-mannosyltransferase
Transmembrane Domains
StartEnd
7698
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO87265833273380
JG9098862831494310
JG8692312661343990
GT0428022542194720
GO872658193373553.1
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)