y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g02070.1
FamilyGH31
Protein PropertiesLength: 940 Molecular Weight: 103222 Isoelectric Point: 6.9187
ChromosomeChromosome/Scaffold: 2 Start: 1402349 End: 1407745
Descriptionalpha-xylosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH312777740
  FYFFAGPTPLAVVDQYTAMIGRPAPMPYWAFGFHQCRWGYQNLSVVEAVVEGYRNAQIPLDVIWNDDDHMDAAKDFTLDPVNYPRPKLLAFLDKIHAQGM
  KYIVLIDPGIAVNSSYGVYQRGMERDIFIKLDGQPYLAQVWPGPVYFPDFLNPNGASWWIDEVRRFHELVPVDGLWIDMNEVSNFCTGKCTIPTTHKCPV
  PNSKEPWLCCLDCKNLTNTRWDDPPYKINASGKSAPLGYNTIATSATHYNGILEYNAHSLYGFSQAIATHKGLQGLQGKRPFILTRSTFVGSGAYAAHWT
  GDNKGTWENLRYSISTILNFGIFGMPMVGADICGFYPADPNLLEELCSRWIELGAFYPFSRDHANFASPRQELYIWGSVAKSARNALGMRYRMLPYLYTL
  NYHAHQSGAPVARPLFFAFPDFVPGYGVSTQFLLGDSVMVSPVLEQGATSVSAVFPPGTWYNLFDTRKVIVSGNNGDAVKLDAPLNEINVHVHEGTVL
Full Sequence
Protein Sequence     Length: 940     Download
MLVTRFSPHL FPWRLLLLFL TLVGSSNGAV AAPAKAHPPR PKAAAGFGYK LVSLVELPNG    60
GGLVGSLQLK QPSSTYGPDI ARLRLFVKHE TQDRVRVQIT DAEKQRWEVP YDLLPREPAP    120
PLTKLPGGAP FTTGEYSGQS LSFTYGRDPF HFAVHRKSTG QTLFNTSHGG PLVFKDQYLE    180
LTTRLPKDAA LYGLGENTQP GGIKLRPNDP YTIFTTDASA INLNTDLYGS HPVYVDLRNI    240
GGHGVAHAVL LLNSNAMDVF YRGDSLTYKV IGGLLDFYFF AGPTPLAVVD QYTAMIGRPA    300
PMPYWAFGFH QCRWGYQNLS VVEAVVEGYR NAQIPLDVIW NDDDHMDAAK DFTLDPVNYP    360
RPKLLAFLDK IHAQGMKYIV LIDPGIAVNS SYGVYQRGME RDIFIKLDGQ PYLAQVWPGP    420
VYFPDFLNPN GASWWIDEVR RFHELVPVDG LWIDMNEVSN FCTGKCTIPT THKCPVPNSK    480
EPWLCCLDCK NLTNTRWDDP PYKINASGKS APLGYNTIAT SATHYNGILE YNAHSLYGFS    540
QAIATHKGLQ GLQGKRPFIL TRSTFVGSGA YAAHWTGDNK GTWENLRYSI STILNFGIFG    600
MPMVGADICG FYPADPNLLE ELCSRWIELG AFYPFSRDHA NFASPRQELY IWGSVAKSAR    660
NALGMRYRML PYLYTLNYHA HQSGAPVARP LFFAFPDFVP GYGVSTQFLL GDSVMVSPVL    720
EQGATSVSAV FPPGTWYNLF DTRKVIVSGN NGDAVKLDAP LNEINVHVHE GTVLPLQRGG    780
SISRDARATP FTLVIAFPFG AADADAEGAV YVDDDERPAM VLAEGEATYV RFHASVRGGK    840
EVTVRSEVSM GSYSLKKGLV VEKLSVLGLE GSGRDLAVRV DGTEEADATA IAVASAHFVG    900
ADEKLQEVGK KRSVMVEVGG LALPLGKSFT MTWNMHIQA*                          960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01055Glyco_hydro_312.0e-86278465188+
PLN02763PLN027636.0e-93182814650+
cd06603GH31_GANC_GANAB_alpha3.0e-97297684397+
pfam01055Glyco_hydro_311.0e-109523774254+
cd06604GH31_glucosidase_II_MalA8.0e-112297684391+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAA99366.101593918929putative alpha-glucosidase [Oryza sativa Japonica Group]
DDBJBAG72143.1029391954alpha-glucosidase [Hordeum vulgare subsp. vulgare]
GenBankEEC69878.101593918929hypothetical protein OsI_00249 [Oryza sativa Indica Group]
RefSeqNP_001041922.101593921932Os01g0130400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002457434.102493923928hypothetical protein SORBIDRAFT_03g007230 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3w38_A04489340871A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3w37_A04489340871A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ctt_A06093362868A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2qmj_A06093362868A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2qly_A06093362868A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-2141EC-3.2.1.20α-glucosidase
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7953076762609350
HO777477522465590
DV0333832753766500
HO777477205715900.008
HO777477155555690.008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00336.5Aquca_014_00336.4Aquca_014_00336.3Aquca_014_00336.2Aquca_014_00336.1
Aquca_014_00336.6Aquca_026_00375.1Aquca_026_00374.1Aquca_026_00373.1Aquca_005_00561.8
Aquca_005_00561.7Aquca_005_00561.5Aquca_005_00561.4Aquca_005_00561.3Aquca_005_00561.2
Aquca_005_00561.1Aquca_005_00561.6Aquca_002_01146.1
Arabidopsis lyrata919683898886909139484972894626
865511862774
Arabidopsis thalianaAT5G63840.1AT3G23640.2AT3G23640.1AT5G11720.1AT3G45940.1
AT1G68560.1
Brachypodium distachyonBradi1g69780.1Bradi1g52510.1Bradi2g19280.1Bradi1g32650.1Bradi2g10060.1
Brassica rapaBra024240Bra037754Bra028332Bra035407Bra004319
Bra006111Bra004031Bra028330
Carica papayaevm.model.supercontig_37.16evm.model.supercontig_1.180evm.model.supercontig_71.57evm.model.supercontig_5.162
Capsella rubellaCarubv10025824mCarubv10012876mCarubv10015582mCarubv10002711mCarubv10019747m
Chlamydomonas reinhardtiiCre03.g190500.t1.2Cre03.g194700.t1.3
Citrus clementinaCiclev10000200mCiclev10014196mCiclev10000152mCiclev10017610mCiclev10033422m
Ciclev10014274mCiclev10011016mCiclev10030449m.416.628Ciclev10030449m.416.628Ciclev10013535m
Ciclev10030449m.283.414Ciclev10030449m.283.414Ciclev10000404m.185.329Ciclev10000404m.185.329Ciclev10004303m
Citrus sinensisorange1.1g003671morange1.1g002442morange1.1g002568morange1.1g038998morange1.1g002256m
orange1.1g020492morange1.1g021825morange1.1g022976morange1.1g021612morange1.1g046216m
orange1.1g014924morange1.1g025445morange1.1g016744morange1.1g016738morange1.1g044305m
orange1.1g048354morange1.1g020723morange1.1g040705m
Cucumis sativusCucsa.228080.1Cucsa.322440.1Cucsa.236670.1Cucsa.365330.1Cucsa.283630.1
Cucsa.068450.1
Eucalyptus grandisEucgr.I00112.6Eucgr.I00112.5Eucgr.I00112.4Eucgr.I00112.3Eucgr.I00112.2
Eucgr.I00112.1Eucgr.E01212.2Eucgr.E01212.1Eucgr.K01952.1Eucgr.E01209.1
Eucgr.K01962.1Eucgr.K01954.1Eucgr.K01958.1Eucgr.L01888.1Eucgr.K01960.1
Eucgr.K01964.1Eucgr.L02199.1Eucgr.K01949.1Eucgr.G02327.1Eucgr.K01956.1
Eucgr.K01957.1Eucgr.K01953.1Eucgr.K01950.1Eucgr.L00881.1.54.343Eucgr.L00881.1.54.343
Eucgr.K01961.1Eucgr.L01889.1.188.355Eucgr.L01889.1.188.355Eucgr.L00881.1.347.493Eucgr.L00881.1.347.493
Eucgr.K01959.1Eucgr.A02235.1Eucgr.G00330.1
Fragaria vescamrna24190.1-v1.0-hybridmrna20103.1-v1.0-hybrid.273.739mrna20103.1-v1.0-hybrid.273.739mrna03754.1-v1.0-hybridmrna24638.1-v1.0-hybrid
mrna21878.1-v1.0-hybrid
Glycine maxGlyma04g38630.1Glyma06g16371.1Glyma09g03250.1Glyma15g14150.1Glyma04g14810.1
Glyma15g14140.2Glyma09g34850.1Glyma01g20460.1Glyma08g31890.1Glyma10g42140.1
Glyma15g14160.2Glyma03g28281.1
Gossypium raimondiiGorai.007G066900.6Gorai.007G066900.3Gorai.007G066900.2Gorai.007G066900.1Gorai.007G066900.4
Gorai.007G066900.5Gorai.009G115500.3Gorai.009G115500.1Gorai.005G124100.2Gorai.005G124100.1
Gorai.013G076300.2Gorai.013G076300.1Gorai.009G115500.2Gorai.007G368700.2Gorai.007G368700.1
Gorai.008G183500.2Gorai.008G183500.1Gorai.009G115500.4Gorai.013G001500.1Gorai.013G001500.2
Gorai.013G001500.3
Linum usitatissimumLus10033490Lus10020887Lus10038408Lus10008067Lus10034315
Lus10041457Lus10035020Lus10035019Lus10035671Lus10000779
Lus10000778Lus10021679Lus10031003
Malus domesticaMDP0000144090MDP0000178546MDP0000139428MDP0000894015MDP0000455477
MDP0000192721MDP0000208161MDP0000296747MDP0000169457MDP0000519142
MDP0000127634MDP0000776779MDP0000662421MDP0000238176
Manihot esculentacassava4.1_001195mcassava4.1_001191mcassava4.1_022477mcassava4.1_027331mcassava4.1_002192m
cassava4.1_001205mcassava4.1_001244mcassava4.1_001233mcassava4.1_002780mcassava4.1_006053m
cassava4.1_004250mcassava4.1_008696mcassava4.1_007575m
Medicago truncatulaMedtr3g096870.1AC235665_67.1Medtr5g026610.1Medtr5g057990.1Medtr2g031110.1.69.543
Medtr2g031110.1.69.543Medtr2g031110.1.69.543AC233660_42.1AC233660_28.1Medtr7g089780.1
Mimulus guttatusmgv1a001552mmgv1a001027mmgv1a001815mmgv1a001054mmgv1a000795m
mgv1a000741mmgv1a000940mmgv1a003100mmgv1a001294m
Oryza sativaLOC_Os03g11720.1LOC_Os06g46340.1LOC_Os06g46284.2LOC_Os06g46284.1LOC_Os07g23880.1
LOC_Os01g03950.1LOC_Os07g23944.1LOC_Os01g16310.1
Panicum virgatumPavirv00007084mPavirv00007083mPavirv00059282mPavirv00000653mPavirv00014847m
Pavirv00031858mPavirv00011190mPavirv00049442mPavirv00025581mPavirv00065694m
Pavirv00021444m
Physcomitrella patensPp1s109_267V6.2Pp1s109_267V6.1Pp1s5_330V6.1Pp1s242_48V6.1Pp1s140_141V6.1
Pp1s41_235V6.1Pp1s60_162V6.1Pp1s157_63V6.1Pp1s25_97V6.1Pp1s11_406V6.1
Pp1s80_200V6.1Pp1s86_178V6.1Pp1s13_451V6.1Pp1s264_36V6.1Pp1s264_60V6.1
Pp1s119_138V6.1Pp1s6_50V6.1Pp1s43_19V6.1Pp1s245_102V6.1Pp1s281_10V6.1
Pp1s41_238V6.1Pp1s65_69V6.1
Phaseolus vulgarisPhvul.009G153400.1Phvul.002G127000.1Phvul.006G125100.1Phvul.002G126900.1Phvul.003G035400.1
Phvul.007G026900.1Phvul.001G123000.1
Picea abiesMA_10430549g0010MA_102800g0010MA_110168g0010MA_9807255g0010MA_10426288g0010
MA_10431114g0020MA_10436707g0010MA_10431114g0010MA_10435316g0010MA_5372344g0010
Populus trichocarpaPotri.007G100000.1Potri.005G069000.1Potri.001G129600.4Potri.001G129600.2Potri.011G154200.1
Potri.011G154300.1Potri.001G129600.1Potri.011G154500.2Potri.011G154500.1Potri.001G442800.1
Potri.001G129600.3Potri.010G125800.1Potri.008G120000.2Potri.008G120000.1Potri.001G442800.2
Potri.006G039500.1Potri.001G442700.1
Prunus persicappa001032mppa001168mppa001103mppa001098mppa000927m
ppa001232m
Ricinus communis29687.m00059729827.m00260228458.m00004829776.m00046827524.m000301
29733.m00074634899.m00001952272.m000013
Setaria italicaSi034132mSi005827mSi028815mSi000221mSi000237m
Selaginella moellendorffii142083923397985582321
Sorghum bicolorSb01g042750.1Sb10g027110.1Sb03g007230.1Sb02g010060.1.193.392Sb02g010060.1.193.392
Sb02g010060.1.393.531Sb02g010060.1.393.531Sb03g010640.1.716.836Sb03g010640.1.716.836Sb03g010640.1.427.700
Sb03g010640.1.427.700
Thellungiella halophilaThhalv10003620mThhalv10019990mThhalv10019989mThhalv10012616mThhalv10012743m
Thhalv10018167mThhalv10018090m
Vitis viniferaGSVIVT01020935001GSVIVT01024287001GSVIVT01022815001GSVIVT01037959001.254.722GSVIVT01037959001.254.722
GSVIVT01011904001GSVIVT01036946001GSVIVT01033641001
Volvox carteriVocar20005557m
Zea maysAC203753.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)