y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g04440.1
FamilyGT58
Protein PropertiesLength: 424 Molecular Weight: 48295.6 Isoelectric Point: 9.798
ChromosomeChromosome/Scaffold: 2 Start: 3130296 End: 3133988
Descriptionasparagine-linked glycosylation 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT58283840
  AFLLLADAALVALIVAFVPYTKIDWDAYMSQVDAFREGERDYTKIEGDTGPLVYPAGFLYVYSAIKFLTAGQVFPAQILFGVLYIVNLSLVMLLYVKSEV
  LPWWALGLLCLSKRIHSIFVLRLFNDCIAMTLLHAAMVLIIYHKWYLGLIIFSGAVSVKMNVLLFAPSLFLLMLKAMSIKGVVFALLGAAGVQVLLGFPF
  LLSHPVEYISRAFDLGRVFIHFWSVNFKFVPEKLFVSKELAVALLFFHLTALMVFAHYKWFKHEGGLFRFVHSRFGDATSIQQLISYKPEHIVTVMFVGN
  FIGIVCARSLHYQFYSWYFYSLPFLLWRTQFPTVVRIILFVGVELCWNIYPSTAYSS
Full Sequence
Protein Sequence     Length: 424     Download
MARTRTMKER GASAPGTPAD RRPLYFAAFL LLADAALVAL IVAFVPYTKI DWDAYMSQVD    60
AFREGERDYT KIEGDTGPLV YPAGFLYVYS AIKFLTAGQV FPAQILFGVL YIVNLSLVML    120
LYVKSEVLPW WALGLLCLSK RIHSIFVLRL FNDCIAMTLL HAAMVLIIYH KWYLGLIIFS    180
GAVSVKMNVL LFAPSLFLLM LKAMSIKGVV FALLGAAGVQ VLLGFPFLLS HPVEYISRAF    240
DLGRVFIHFW SVNFKFVPEK LFVSKELAVA LLFFHLTALM VFAHYKWFKH EGGLFRFVHS    300
RFGDATSIQQ LISYKPEHIV TVMFVGNFIG IVCARSLHYQ FYSWYFYSLP FLLWRTQFPT    360
VVRIILFVGV ELCWNIYPST AYSSLLLLFL HILILFGLWR SPAEYPYVDK KDKPHSNKLG    420
KAM*                                                                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05208ALG32.0e-13246384348+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF84701.1014161431unknown [Zea mays]
GenBankEAY72720.1013701372hypothetical protein OsI_00584 [Oryza sativa Indica Group]
GenBankEAZ10720.1013701372hypothetical protein OsJ_00555 [Oryza sativa Japonica Group]
RefSeqNP_001143883.1014161431hypothetical protein LOC100276684 [Zea mays]
RefSeqXP_002455106.1034126423hypothetical protein SORBIDRAFT_03g004440 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
2446
100122
145167
177199
208230
266288
320342
352374
381403
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT046057324553710
DV4692262391403780
HS3529202551774230
HS352920115661800
DR736742270793410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00758.1Aquca_003_00758.2Aquca_003_00758.3
Arabidopsis lyrata904250
Arabidopsis thalianaAT2G47760.3AT2G47760.1AT2G47760.2
Brassica rapaBra000461.29.139Bra004431
Carica papayaevm.model.supercontig_9.209
Capsella rubellaCarubv10023173m
Citrus clementinaCiclev10020260m
Citrus sinensisorange1.1g014346morange1.1g015618m.102.369orange1.1g015618m.102.369orange1.1g015618m.30.104orange1.1g015618m.30.104
Cucumis sativusCucsa.205720.1
Eucalyptus grandisEucgr.H01160.1
Fragaria vescamrna10569.1-v1.0-hybrid
Glycine maxGlyma19g39740.1Glyma03g37130.1
Gossypium raimondiiGorai.008G011100.2Gorai.008G011100.1
Linum usitatissimumLus10031921Lus10035085
Malus domesticaMDP0000161757
Manihot esculentacassava4.1_008035m
Medicago truncatulaMedtr7g108620.1
Mimulus guttatusmgv1a006267mmgv1a008112m
Oryza sativaLOC_Os01g07720.4LOC_Os01g07720.2
Panicum virgatumPavirv00058096mPavirv00012164m
Physcomitrella patensPp1s58_150V6.1
Phaseolus vulgarisPhvul.001G205800.1
Picea abiesMA_10426799g0010
Populus trichocarpaPotri.014G131600.2Potri.014G131600.1Potri.014G131600.3
Prunus persicappa005841m
Ricinus communis30129.m000370
Setaria italicaSi001564m
Selaginella moellendorffii96090
Sorghum bicolorSb03g004440.1
Thellungiella halophilaThhalv10001458m
Vitis viniferaGSVIVT01027976001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny