y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g05580.1
FamilyAA7
Protein PropertiesLength: 522 Molecular Weight: 55393.7 Isoelectric Point: 5.3174
ChromosomeChromosome/Scaffold: 2 Start: 4063596 End: 4066579
Descriptioncytokinin oxidase 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7655182.4e-25
  SALPAAVLFPSSPADIAALLRAAAGKVSFRGRGHSVMGQALAPGGVVVDMPSLGLGLGLSGARINVSADGGYVDAGGEQQWIDVLRAALRQGVAPRSWTD
  YLRLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGNGETVTCSKSENADLFDAALGGLGQFGVIVRARIPLEPAPARARWVRLVYTDFATFSADQERV
  IAGAADSAFGAVSYLEGAAYVNQSLASGLKNAGGFYSDADVSRIVALAALRNASSLYAIELTLNYVNATAVDQEFEAVVGELRHETGFAFARDVAYEAFL
  DRVYEEEVALEKLGLWRVPHPWLNVLVPSSRIADFDRAVFKGILQGTDIAGPLVIYPLNKSKWDEGMSAVTPAEEVFYAVSLLFSSVANDLKKLQAQNQK
  ILQFCDMAGIGYKEYLAHYTTRGDWARHFGDKWDRFVQRKDKYDPKKLLCPGQD
Full Sequence
Protein Sequence     Length: 522     Download
MAAAYVLALA ALLALASSSS QQYANAQASL LHGDDALAAL AAAGKLRTDA TATAAASTDF    60
GNITSALPAA VLFPSSPADI AALLRAAAGK VSFRGRGHSV MGQALAPGGV VVDMPSLGLG    120
LGLSGARINV SADGGYVDAG GEQQWIDVLR AALRQGVAPR SWTDYLRLTV GGTLSNAGIS    180
GQAFRHGPQI SNVLELDVIT GNGETVTCSK SENADLFDAA LGGLGQFGVI VRARIPLEPA    240
PARARWVRLV YTDFATFSAD QERVIAGAAD SAFGAVSYLE GAAYVNQSLA SGLKNAGGFY    300
SDADVSRIVA LAALRNASSL YAIELTLNYV NATAVDQEFE AVVGELRHET GFAFARDVAY    360
EAFLDRVYEE EVALEKLGLW RVPHPWLNVL VPSSRIADFD RAVFKGILQG TDIAGPLVIY    420
PLNKSKWDEG MSAVTPAEEV FYAVSLLFSS VANDLKKLQA QNQKILQFCD MAGIGYKEYL    480
AHYTTRGDWA RHFGDKWDRF VQRKDKYDPK KLLCPGQDIF N*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01678FAD_lactone_ox5.0e-816924072+
pfam01565FAD_binding_43.0e-1868209146+
COG0277GlcD5.0e-2466517465+
pfam09265Cytokin-bind4.0e-131241520286+
PLN02441PLN02441060521472+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0009690cytokinin metabolic process
GO:0016491oxidoreductase activity
GO:0019139cytokinin dehydrogenase activity
GO:0050660flavin adenine dinucleotide binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1W1O015211534A Chain A, Native Cytokinin Dehydrogenase
GenBankADB45878.1015211525cytokinin oxidase/dehydrogenase [Bambusa oldhamii]
GenBankADB45880.1015211522cytokinin oxidase/dehydrogenase [Bambusa oldhamii]
RefSeqNP_001105591.1015211534cytokinin oxidase1 precursor [Zea mays]
Swiss-ProtQ9T0N8015211534CKX1_MAIZE RecName: Full=Cytokinin dehydrogenase 1; AltName: Full=Cytokinin oxidase 1; Short=CKO 1; Short=COX 1; AltName: Full=ZmCKX1; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w1s_A015211534A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1w1r_A015211534A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1w1q_A015211534A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1w1o_A015211534A Chain A, Native Cytokinin Dehydrogenase
PDB3s1c_A03652119516A Chain A, Native Cytokinin Dehydrogenase
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins degradationRXN-4621EC-1.5.99isopentenyladenine:FAD oxidoreductase
cytokinins degradationRXN-4641EC-1.5.99isopentenyl adenosine:FAD oxidoreductase
cytokinins degradationRXN-4661EC-1.5.99trans-zeatin:FAD oxidoreductase
cytokinins degradationRXN-4662EC-1.5.99cis-zeatin:FAD oxidoreductase
cytokinins degradationRXN-4681EC-1.5.99trans-zeatin riboside:FAD oxidoreductase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC8730442761784470
EC896115286973760
EE156479282973720
FL895405265973580
FE658557254973470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01436.1Aquca_002_01436.2Aquca_014_00736.1Aquca_007_00318.1Aquca_009_00356.1
Aquca_010_00588.1
Arabidopsis lyrata483228489034867825476695857642
918856480522
Arabidopsis thalianaAT2G41510.1AT5G21482.1AT3G63440.1AT1G75450.1AT1G75450.2
AT4G29740.2AT4G29740.1AT5G56970.1AT2G19500.1
Brachypodium distachyonBradi3g29130.2Bradi3g29130.1Bradi2g27170.1Bradi2g60456.1Bradi3g08230.1
Bradi2g06030.1Bradi1g37470.1Bradi3g08220.1Bradi3g37690.1Bradi2g51530.1
Brassica rapaBra016928Bra020157Bra002371Bra007743Bra000229
Bra004626Bra015842Bra040677Bra002777Bra036719
Bra035640Bra024135
Carica papayaevm.model.supercontig_182.26evm.model.supercontig_2087.1evm.model.supercontig_126.29
Capsella rubellaCarubv10022823mCarubv10018610mCarubv10000702mCarubv10026233mCarubv10013466m
Carubv10023000mCarubv10020114m
Chlamydomonas reinhardtiig9859.t1
Citrus clementinaCiclev10006491mCiclev10008441mCiclev10007999mCiclev10000709mCiclev10007992m
Ciclev10031210m
Citrus sinensisorange1.1g009956morange1.1g016403morange1.1g008291morange1.1g042782morange1.1g009793m
orange1.1g022399m
Cucumis sativusCucsa.018150.1Cucsa.231890.1Cucsa.155270.1Cucsa.299790.2Cucsa.299790.1
Cucsa.166070.1Cucsa.117040.1Cucsa.155280.1
Eucalyptus grandisEucgr.F01857.1Eucgr.G03270.1Eucgr.K01574.1Eucgr.C03157.1Eucgr.C00881.1
Eucgr.H03195.1Eucgr.C00883.1Eucgr.H03393.1Eucgr.H03190.1Eucgr.H03197.1
Fragaria vescamrna21961.1-v1.0-hybridmrna15204.1-v1.0-hybridmrna30442.1-v1.0-hybridmrna14452.1-v1.0-hybridmrna15382.1-v1.0-hybrid
mrna30654.1-v1.0-hybridmrna12649.1-v1.0-hybridmrna12648.1-v1.0-hybrid
Glycine maxGlyma09g07190.4Glyma09g07190.3Glyma09g07190.2Glyma09g07190.1Glyma14g11280.1
Glyma03g28910.2Glyma12g01390.2Glyma12g01390.1Glyma19g31620.1Glyma09g35950.1
Glyma13g16430.1Glyma11g20860.1Glyma17g06220.1Glyma17g06230.1Glyma13g16420.2
Glyma09g07360.1Glyma06g03180.1Glyma15g18560.1Glyma04g03130.1Glyma06g03180.2
Glyma17g34330.1
Gossypium raimondiiGorai.011G295400.1Gorai.012G081000.1Gorai.009G198300.4Gorai.009G198300.3Gorai.009G198300.2
Gorai.009G198300.1Gorai.013G014800.1Gorai.010G083400.1Gorai.006G134800.1Gorai.004G286300.1
Gorai.009G040700.4Gorai.009G040700.3Gorai.009G040700.2Gorai.009G040700.1Gorai.010G096700.3
Gorai.010G096700.2Gorai.010G096700.1Gorai.013G227400.1Gorai.001G012300.1Gorai.010G007500.1
Gorai.002G126300.1Gorai.013G221000.1
Linum usitatissimumLus10035433Lus10031046Lus10039574Lus10005317Lus10026471
Lus10018039Lus10016363Lus10024289Lus10003845Lus10027611
Lus10031765Lus10031188Lus10031200
Malus domesticaMDP0000223673MDP0000318353MDP0000293966MDP0000256199MDP0000250917
MDP0000238100MDP0000271354MDP0000312902MDP0000213431MDP0000211550
MDP0000279125
Manihot esculentacassava4.1_033022mcassava4.1_029100mcassava4.1_004923mcassava4.1_005650mcassava4.1_008801m
cassava4.1_005737mcassava4.1_033151m
Medicago truncatulaMedtr1g015410.1Medtr7g090920.1Medtr3g036100.1Medtr4g044110.1Medtr2g039410.1
Mimulus guttatusmgv1a004484mmgv1a022053mmgv1a004444mmgv1a004144mmgv1a004294m
Oryza sativaLOC_Os08g35860.1LOC_Os05g31040.1LOC_Os10g34230.1LOC_Os01g71310.1LOC_Os04g44230.1
LOC_Os01g09260.1LOC_Os02g12780.1LOC_Os01g10110.1LOC_Os06g37500.1LOC_Os01g56810.1
Panicum virgatumPavirv00052903mPavirv00063358mPavirv00060424mPavirv00044659mPavirv00018118m
Pavirv00028994mPavirv00031945mPavirv00035115mPavirv00059528mPavirv00068235m
Pavirv00015211mPavirv00010010mPavirv00027542mPavirv00001793m
Physcomitrella patensPp1s403_31V6.1Pp1s595_6V6.1Pp1s222_49V6.1Pp1s152_115V6.1
Phaseolus vulgarisPhvul.001G038800.1Phvul.001G128800.1Phvul.011G014000.1Phvul.005G034000.1Phvul.009G060200.1
Phvul.003G136400.1Phvul.003G136500.1Phvul.009G081800.1Phvul.009G231700.1Phvul.009G231800.1
Picea abiesMA_173695g0010MA_31778g0010MA_113618g0010MA_42031g0010MA_17212g0010
MA_138486g0010MA_32541g0010MA_23320g0010MA_10433485g0010MA_5215129g0010
MA_197101g0010
Populus trichocarpaPotri.016G044100.1Potri.006G047900.1Potri.001G020900.1Potri.003G203600.1Potri.005G232300.1
Potri.002G030500.1Potri.006G152500.1Potri.006G221000.1Potri.007G066100.1
Prunus persicappa024442mppa004120mppa003895mppb021417mppa004276m
ppa021859m
Ricinus communis29912.m00533430131.m00725529614.m00004030170.m01410329739.m003615
30169.m006344
Setaria italicaSi001018mSi021761mSi035175mSi000960mSi012051m
Si019278mSi008391mSi013710mSi013569m
Selaginella moellendorffii17472198722
Sorghum bicolorSb07g022530.1Sb09g018640.1Sb03g045410.1Sb01g019000.1Sb03g003280.1
Sb03g002810.1Sb04g007740.1Sb04g007730.1Sb06g022930.1Sb10g022590.1
Thellungiella halophilaThhalv10013259mThhalv10016470mThhalv10005878mThhalv10018378mThhalv10013271m
Thhalv10024918mThhalv10023158m
Vitis viniferaGSVIVT01001461001GSVIVT01005041001GSVIVT01009786001GSVIVT01015194001GSVIVT01028599001
GSVIVT01028610001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)