y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g06130.1
FamilyGT1
Protein PropertiesLength: 473 Molecular Weight: 50610.6 Isoelectric Point: 6.4674
ChromosomeChromosome/Scaffold: 2 Start: 4605459 End: 4606998
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12324543.4e-40
  AVGPLNPLLEPDYRLDATAHGDQQPRHECLDWLDKQPAASVLYVSFGSTSSLRGAQVKELADALHGSKQRFIWVLRDADRGNVFTADADADTDRHANLLS
  EFTAQTKGTGLVITGWAPQLEILAHGATAAFMSHCGWNSTVESMSHGKPMLAWPMHSDQPWDAQFVCRHLKAGILVRPWEEHGEVTPAAAIRAAIETAMV
  GEEGKAMRARAMALGEAVRSCAA
Full Sequence
Protein Sequence     Length: 473     Download
MESVAVVAVP FPMQGHLNQL LHLSLQLASR GLELHYAAPA AHVRQARARV QGWPAAALRS    60
IHFHELGIAA FSAPPPDPDA ASPFPTHIMP MWAAYIADAA APLAALLREL SASRRRVVVV    120
HDVLNSFAAV EAARLSKGNG ESFGLYCGAV SYMVGMMHGA GHGLLRENGL EYAPMDAYVS    180
KEFMDCAREQ SSMAQAVSRG GGIITNTCRA LEGEFVDAVA ENLAAAGQKL FAVGPLNPLL    240
EPDYRLDATA HGDQQPRHEC LDWLDKQPAA SVLYVSFGST SSLRGAQVKE LADALHGSKQ    300
RFIWVLRDAD RGNVFTADAD ADTDRHANLL SEFTAQTKGT GLVITGWAPQ LEILAHGATA    360
AFMSHCGWNS TVESMSHGKP MLAWPMHSDQ PWDAQFVCRH LKAGILVRPW EEHGEVTPAA    420
AIRAAIETAM VGEEGKAMRA RAMALGEAVR SCAAVGGSSR EDLEVLVAHV TR*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030075.0e-42174471311+
PLN02863PLN028634.0e-42202472271+
PLN02448PLN024489.0e-44231471243+
PLN02534PLN025346.0e-45177472310+
PLN00164PLN001644.0e-48202472274+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACD03254.1014728465UDP-glycosyltransferase UGT93B9 [Avena strigosa]
EMBLCAH66756.1024729464OSIGBa0158F05.5 [Oryza sativa (indica cultivar-group)]
RefSeqNP_001053572.1024729464Os04g0565200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001136576.1014723468hypothetical protein LOC100216698 [Zea mays]
RefSeqXP_002446923.1014721464hypothetical protein SORBIDRAFT_06g024950 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0647011477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A5.00264e-43181466180463A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A5.00264e-43181466180463A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A5.00264e-43181466180463A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A1e-33193472207452A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ9028172801944730
BQ9027682801944730
BQ8382622371613960
EG3969312622104710
FF3400092462284730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi5g18020.1Bradi5g18040.1Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)