y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g06627.1
FamilyGT22
Protein PropertiesLength: 612 Molecular Weight: 69524 Isoelectric Point: 8.6844
ChromosomeChromosome/Scaffold: 2 Start: 5062508 End: 5067323
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22534840
  LALGLLRHMSASSNLIHDCDEVFNYWEPLHFLLYRSGFQTWEYSSDHALRSYLYLFIHGIVAGPASLIFGEHKVRVFYAVRIFLGLISTVTETVLVVAIS
  RRYGKRLACYVLAMLCLTSGCFFASTSFLPSSFSMYAVTLSSALFLLEKYTGAVSVAAAGVLLGWPFSILVFLPVTVYSLIRGSFKRVFLSGLLTSLCLL
  VSNAFSPLQYRLFYTVNKFRFDMINTNFRQALSLVADYYCYGRWTSSVFNLLKYNVLGGGESHLYGTEGAMFYFKNAFNNFNFAFVLALLFLGVALSAGK
  KYAPDLLIVISPIYIWLAFMSLQAHKEERFLYPIYPLICVAAAAVIDSFPGFFHDKYSSEQSIFEKTAKFLRPLVLGFILCTSHSRTFSMLNGYGAPLQI
  YEHLDYHEDTGPGSTLCVGSEWHRYPSSFFVP
Full Sequence
Protein Sequence     Length: 612     Download
MSLSSVRQRR PTAASSLTDD SQENRYSKDG NDRRRRSDGE EEDGGIRWFL PFLALGLLRH    60
MSASSNLIHD CDEVFNYWEP LHFLLYRSGF QTWEYSSDHA LRSYLYLFIH GIVAGPASLI    120
FGEHKVRVFY AVRIFLGLIS TVTETVLVVA ISRRYGKRLA CYVLAMLCLT SGCFFASTSF    180
LPSSFSMYAV TLSSALFLLE KYTGAVSVAA AGVLLGWPFS ILVFLPVTVY SLIRGSFKRV    240
FLSGLLTSLC LLVSNAFSPL QYRLFYTVNK FRFDMINTNF RQALSLVADY YCYGRWTSSV    300
FNLLKYNVLG GGESHLYGTE GAMFYFKNAF NNFNFAFVLA LLFLGVALSA GKKYAPDLLI    360
VISPIYIWLA FMSLQAHKEE RFLYPIYPLI CVAAAAVIDS FPGFFHDKYS SEQSIFEKTA    420
KFLRPLVLGF ILCTSHSRTF SMLNGYGAPL QIYEHLDYHE DTGPGSTLCV GSEWHRYPSS    480
FFVPSYISEV RWIDDGFRGL LPFPFNETLG GTTAAPSYFN NKNKASDQQY LKDIGSCNLL    540
MELDLRRPYP SRGNDLSTWE TLAALPFLDR ELSPALYRSF FIPYKWQQKN VFGLYKLLRR    600
LPTDQEQFKG H*                                                        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028160.002264389131+
pfam03901Glyco_transf_222.0e-7947484457+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.1046023569hypothetical protein [Vitis vinifera]
GenBankEEC70146.1016051571hypothetical protein OsI_00847 [Oryza sativa Indica Group]
RefSeqNP_001042360.1016051571Os01g0209000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148995.1016051573alpha-1,2-mannosyltransferase ALG9 [Zea mays]
RefSeqXP_002457152.1016051573hypothetical protein SORBIDRAFT_03g002210 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5467EC-2.4.1.259Dol-P-Man:Man6GlcNAc2-PP-Dol α-1,2-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5469EC-2.4.1.261Dol-P-Man:Man8GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
103120
130152
159181
205227
240262
329351
358377
382404
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0350883642215840
EC3655242933025940
GO8535923401454840
FF5866622283525790
GO853592374785120.00000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma13g34570.2Glyma12g35831.2Glyma12g35831.1Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny