y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g07150.1
FamilyCBM49
Protein PropertiesLength: 629 Molecular Weight: 67702.6 Isoelectric Point: 6.565
ChromosomeChromosome/Scaffold: 2 Start: 5483099 End: 5485957
Descriptionglycosyl hydrolase 9C3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495346133.6e-27
  IAIEQNVTASWTEKGRTYTRYVVTVTNGYPHKTVQELHIGVAKLYGPVWGLRETRYGYVLPGSDPALLPAGGSAVFVYVH
GH9244890
  DYGTALSKSILFLEAQRSGTLPSSQRIAWRANSGLLDGKANGVDLTGGYYDAGDNVKFGLPMAFTVTMMSWSIVEYGEQMAAAGQLDHAVEAVKWGTDYF
  IKAHPEANVLYGEVGDGDSDHSCWQRPEDMTTSRQAYRLDTQHPGSELAGETAAAMAAASLVFRRSNPGYASQLLQHSKQLFDFADKYRGRYDTSIPVAK
  GYYGSVSGYGDELLWASAWLYQATNDEHYLAYLANNGDSLGGTGWSTNQFGWDIKYPGVQVLASKILLQGKAGAAAHAGALRRYQQKADLFACSCLGKAS
  NNNVQRTPGGMLYFQKWNNLQFVTSAAFLLAAYSDHLGQAKRAVQCPSGSTAQPAELLSFATAQVDYILGSNPRATSYMVGYGATYPREAHHRGASIVSF
  KSDPSFVGCNEGYSNWYGRKGSNPNLLDGAIVGGPDEYDNFADERNNYQQTEPTTYNNAPLMGVLA
Full Sequence
Protein Sequence     Length: 629     Download
MAALLVILVL TAMAQVAYCG GGHDYGTALS KSILFLEAQR SGTLPSSQRI AWRANSGLLD    60
GKANGVDLTG GYYDAGDNVK FGLPMAFTVT MMSWSIVEYG EQMAAAGQLD HAVEAVKWGT    120
DYFIKAHPEA NVLYGEVGDG DSDHSCWQRP EDMTTSRQAY RLDTQHPGSE LAGETAAAMA    180
AASLVFRRSN PGYASQLLQH SKQLFDFADK YRGRYDTSIP VAKGYYGSVS GYGDELLWAS    240
AWLYQATNDE HYLAYLANNG DSLGGTGWST NQFGWDIKYP GVQVLASKIL LQGKAGAAAH    300
AGALRRYQQK ADLFACSCLG KASNNNVQRT PGGMLYFQKW NNLQFVTSAA FLLAAYSDHL    360
GQAKRAVQCP SGSTAQPAEL LSFATAQVDY ILGSNPRATS YMVGYGATYP REAHHRGASI    420
VSFKSDPSFV GCNEGYSNWY GRKGSNPNLL DGAIVGGPDE YDNFADERNN YQQTEPTTYN    480
NAPLMGVLAR LAAGGSSRFD RSVSDEIATA GIKSDNRTSL PSLSPAADEH ASPIAIEQNV    540
TASWTEKGRT YTRYVVTVTN GYPHKTVQEL HIGVAKLYGP VWGLRETRYG YVLPGSDPAL    600
LPAGGSAVFV YVHAAPPADV WVTGYKLV*                                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN0217101628631+
PLN02340PLN0234002626627+
PLN02420PLN0242003491496+
PLN00119PLN0011903492490+
pfam00759Glyco_hydro_9024489468+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY73052.10562820640hypothetical protein OsI_00928 [Oryza sativa Indica Group]
RefSeqNP_001042421.10162813640Os01g0219600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001042423.10562820640Os01g0220100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001054920.10262811629Os05g0212300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002454930.101562837654hypothetical protein SORBIDRAFT_03g001560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0234953432A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1ksc_A0234953432A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1ks8_A0234953432A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A02149122459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0245065457B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495381284080
ES821522332283590
DY287831351163660
DY27436539143920
DW0690633141374500
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)