y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g09620.1
FamilyGT4
Protein PropertiesLength: 471 Molecular Weight: 51835.3 Isoelectric Point: 9.9009
ChromosomeChromosome/Scaffold: 2 Start: 7905283 End: 7910179
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42674337.7e-24
  SEDLIFAVINSVSRGKGQDLFLQAFYQSLKLIQHQKLKVPKMHAVVVGSDMNAQTKFETQLREFVAKNGIHDHVHFVNRTLVVPPYLAAIDVLVQNSQAR
  GECFGRITIEAMAFKLPVLGTAAGGTTEIILDGTTGLLHPAGKEGVMPLAKNIVRLASHVEQRISMG
Full Sequence
Protein Sequence     Length: 471     Download
MAKPPPSAAA SAAGVRGQGP HRTRLLLLLL VAVAASASTA GYLLRGALVP PCDAQRDPVV    60
LAAPASPLGF MRSKIVLLVS HELSLSGGPL LLMELAFLLR QVGSQVVWIT NQQPEGTNDA    120
SYSLEHKMLN HGVQILPARG QEAIDTALKA DLVILNTAVA GKWLDAVLKD HVPQVLPKIL    180
WWIHEMRGHY FKLEYVKHLP LVAGAMIDSH TTAEYWKTRT HDRLNIQMPQ TYVVHLGNSE    240
ELMEVAEDNV ARRVLREHIR ESLGVRSEDL IFAVINSVSR GKGQDLFLQA FYQSLKLIQH    300
QKLKVPKMHA VVVGSDMNAQ TKFETQLREF VAKNGIHDHV HFVNRTLVVP PYLAAIDVLV    360
QNSQARGECF GRITIEAMAF KLPVLGTAAG GTTEIILDGT TGLLHPAGKE GVMPLAKNIV    420
RLASHVEQRI SMGNRGYARV KERFMEHHMA DRIAVVLKEV LQKSRQHSHS *             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03819GT1_WavL_like2.0e-19278444167+
COG0438RfaG1.0e-19268464199+
cd03798GT1_wlbH_like7.0e-22260460204+
cd03808GT1_cap1E_like4.0e-24267453188+
cd03801GT1_YqgM_like2.0e-3076456400+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19755.102847017463unnamed protein product [Vitis vinifera]
GenBankEAY73392.101847015482hypothetical protein OsI_01273 [Oryza sativa Indica Group]
RefSeqNP_001042653.101847015482Os01g0262600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002281084.106347072479PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327680.102447022481predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3mbo_H0.00000009336466285411A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate
PDB3mbo_G0.00000009336466285411A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate
PDB3mbo_F0.00000009336466285411A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate
PDB3mbo_E0.00000009336466285411A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate
PDB3mbo_D0.00000009336466285411A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate
Transmembrane Domains
StartEnd
2544
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO869953341694090
HO7808963301374660
DY2903883381054420
HO8056393261414660
HO8142653031664680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)