y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g13780.1
FamilyGT28
Protein PropertiesLength: 436 Molecular Weight: 46973.5 Isoelectric Point: 8.4771
ChromosomeChromosome/Scaffold: 2 Start: 12372376 End: 12376764
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282574173.09967e-42
  LLVLGGTVGSPQINVAVLNMYYEMLTTKKNRYIIWQTGPEDFCEMESLVRGHRRLFLTPFLREMDITYAATDVVVSRAGSVSCTEILVTGKPAILIPLPT
  IVDDHQTKNAYIMADVMGAKVITEDELDSSSLTYTIDEVFGNEKLMAEMSQKALYAARPNA
Full Sequence
Protein Sequence     Length: 436     Download
MVAITRPVSP PLLARRLLRR HPSTQTVSFA GVRPLIIPTE SSGHFRRRRC QVSQSSEPPT    60
PVSDPGTPHD DDDDSLRVAF VCGGAGGHVY AAFALADELR ASLPSSRSLF LGSPAPSLEA    120
ASAASSSYPF VPIPPCLPRA FLAAALHLRR FRPHFLVATG GPPALPTCIA ALLLRLPFVI    180
QDQDAGPAPA TRLLAPLAQR IFLAFNAPVR LLPKRKCAVY GNPVRMSIRD CQVPKAAAMA    240
RFFPGAGLVG EEGAEVLLVL GGTVGSPQIN VAVLNMYYEM LTTKKNRYII WQTGPEDFCE    300
MESLVRGHRR LFLTPFLREM DITYAATDVV VSRAGSVSCT EILVTGKPAI LIPLPTIVDD    360
HQTKNAYIMA DVMGAKVITE DELDSSSLTY TIDEVFGNEK LMAEMSQKAL YAARPNASAD    420
IIRHICSLIG PTNPT*                                                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04101Glyco_tran_28_C7.0e-21269421155+
TIGR01133murG4.0e-3577422365+
COG0707MurG1.0e-3777422361+
PRK00726murG7.0e-5377430370+
cd03785GT1_MurG1.0e-6877424365+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY74292.104943561433hypothetical protein OsI_02179 [Oryza sativa Indica Group]
GenBankEEE54689.104943561433hypothetical protein OsJ_01999 [Oryza sativa Japonica Group]
RefSeqNP_001043195.104943561433Os01g0516700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149881.108943597444glycosyltransferase family 28 C-terminal domain containing protein [Zea mays]
RefSeqXP_002457846.102043516439hypothetical protein SORBIDRAFT_03g015470 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A1e-25784225348A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B1e-20774268351A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A1e-20774268351A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B1e-20774268351A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A1e-20774268351A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8931321722664360
CX6127102062314360
CX6149302022354360
JG9261951712664360
FL9771121702674360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma08g05420.2Glyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3Gorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny