y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g15577.1
FamilyCE10
Protein PropertiesLength: 399 Molecular Weight: 43802.3 Isoelectric Point: 9.1324
ChromosomeChromosome/Scaffold: 2 Start: 13846024 End: 13850468
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101033400
  RSVVYGNQPRNRLDLYIPKDHSKPHPVVAFVTGGAWIIGYKAWGALLGRRLAERGIMVACIDYRNFPQGTIGDMVTDASEGIAFICESIASFGGDPNQIY
  LMGQSAGAHIAACSLLEQAVKESKGEEIYWSVTQIKGYFGLSGGYNVQNLVDHFHERGLYRSIFLSIMEGRRSLADFSPEIVAKKLSPEAIALLPQVVLF
  HGTGDYSIPSSASETFADVLKQAGAKARLQLYKGKTHT
Full Sequence
Protein Sequence     Length: 399     Download
MQPTTPVSAG RAGNSPKNLR RRGPSAPSIP SARWTRTTFR EDVGHAAAET YLVSRLAFIL    60
LRSLGVGYRW ICQLVALLIY AVLLMPGFIK VGQYYFFSSQ VLRSVVYGNQ PRNRLDLYIP    120
KDHSKPHPVV AFVTGGAWII GYKAWGALLG RRLAERGIMV ACIDYRNFPQ GTIGDMVTDA    180
SEGIAFICES IASFGGDPNQ IYLMGQSAGA HIAACSLLEQ AVKESKGEEI YWSVTQIKGY    240
FGLSGGYNVQ NLVDHFHERG LYRSIFLSIM EGRRSLADFS PEIVAKKLSP EAIALLPQVV    300
LFHGTGDYSI PSSASETFAD VLKQAGAKAR LQLYKGKTHT DVFVQDPLRG GKDPLVEDVV    360
SIIQADDPAA REKYDSGPLP ERLVSEWQIM LARQISPF*                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07859Abhydrolase_34.0e-8135339215+
cd00312Esterase_lipase2.0e-9115223126+
pfam00135COesterase6.0e-10115218119+
COG2272PnbA1.0e-10115227127+
COG0657Aes3.0e-24105339242+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD96862.101539841427hypothetical protein [Cleome spinosa]
GenBankEAY99150.10239871458hypothetical protein OsI_21109 [Oryza sativa Indica Group]
GenBankEEE55068.103639847409hypothetical protein OsJ_02788 [Oryza sativa Japonica Group]
RefSeqNP_001056406.1013981414Os05g0577200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132117.10839817404hypothetical protein LOC100193534 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1u4n_A0.000000000611433961282A Chain A, D-Hydantoinase (Dihydropyrimidinase) From Thermus Sp. In Space Group C2221
PDB1qz3_A0.000000000611433961282A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate
PDB2hm7_A0.000000000711433961282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1evq_A0.00000000111433961282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB4e15_B0.00000000310734263282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
Transmembrane Domains
StartEnd
6789
127149
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG945758265733370
GT0431492631373990
GE479256299683630
DY28095632313190
FL959136245603040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)