y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g17920.1
FamilyGH28
Protein PropertiesLength: 227 Molecular Weight: 24057.5 Isoelectric Point: 5.2195
ChromosomeChromosome/Scaffold: 2 Start: 15958734 End: 15961332
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28902098.5e-21
  APKAVHFEGCEDVSVMGITVQNSPRQHLAFTRYYNVKANYLQVTAPEGSPGTVGVLLASSTNVHVMDDLFSVGGDCVSIVGNCTDNLQGHECILLPFLCV
  RKQQISIAEKNNFSIDDISI
Full Sequence
Protein Sequence     Length: 227     Download
MALRARTTPL LPAALAVAFL LSSAAEARVL LTLDDFGAVG DGIANDTQAW SAACAMGDNT    60
YLNVPAGKSY QIWPVTLAGP CRGEIKLLAA PKAVHFEGCE DVSVMGITVQ NSPRQHLAFT    120
RYYNVKANYL QVTAPEGSPG TVGVLLASST NVHVMDDLFS VGGDCVSIVG NCTDNLQGHE    180
CILLPFLCVR KQQISIAEKN NFSIDDISID RTIDMLRGRV DGRSSA*                  240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02218PLN022182.0e-1231177211+
pfam00295Glyco_hydro_282.0e-139016980+
PLN03003PLN030033.0e-1631181206+
PLN03010PLN030107.0e-1936181197+
PLN02793PLN027936.0e-2530173208+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79626.12.8026e-451922123278hypothetical protein OsI_20838 [Oryza sativa Indica Group]
GenBankEEE64553.101922123237hypothetical protein OsJ_19405 [Oryza sativa Japonica Group]
RefSeqNP_001056198.11.4013e-451922123278Os05g0542800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151374.102621724260polygalacturonase [Zea mays]
RefSeqXP_002440168.102621724261hypothetical protein SORBIDRAFT_09g027160 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2uvf_B0.00696182336421A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB2uvf_A0.00696182336421A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB2uve_B0.00696182336421A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase
PDB2uve_A0.00696182336421A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG402793214281740
CT858434207281641e-39
FF347847216281742e-38
FF351756213281741e-37
FE609184179541743e-36
Orthologous Group
SpeciesID
Carica papayaevm.TU.contig_35388.1
Oryza sativaLOC_Os06g16810.1
Prunus persicappa025007m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny