y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g18440.3
FamilyGH35
Protein PropertiesLength: 671 Molecular Weight: 75129.5 Isoelectric Point: 6.4645
ChromosomeChromosome/Scaffold: 2 Start: 16350203 End: 16357695
Descriptionbeta-galactosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35423640
  KDGERFQIVGGDVHYFRIVPEYWKDRLLRAKALGLNTVQTYVPWNLHEPEPQSWEFNGFADIESYLRLAHELEMLVMLRVGPYICGEWDLGGFPPWLLTI
  EPALKLRSSDSAYLSLVERWWKVLLPKVAPLLYSNGGPIIMVQIENEFGSFGDDKNYLHYLVLLARRYLGNDIILYTTDGGTIGTLKNGSIHQDDVFAAV
  DFSTGDDPWPIFRLQKEYNFPGKSAPLTAEFYTGWLTHWGESIATTDASSTAKALKSILCRNGSAVLYMAHGGTNFGFYNGANTGQNESAYKADLTSYDY
  DAPIKEHGDVHNPKYKALRSVIH
Full Sequence
Protein Sequence     Length: 671     Download
MASGRSFLDL CLLALSLCSA LASTVDGGAS RRFWIEGDAF RKDGERFQIV GGDVHYFRIV    60
PEYWKDRLLR AKALGLNTVQ TYVPWNLHEP EPQSWEFNGF ADIESYLRLA HELEMLVMLR    120
VGPYICGEWD LGGFPPWLLT IEPALKLRSS DSAYLSLVER WWKVLLPKVA PLLYSNGGPI    180
IMVQIENEFG SFGDDKNYLH YLVLLARRYL GNDIILYTTD GGTIGTLKNG SIHQDDVFAA    240
VDFSTGDDPW PIFRLQKEYN FPGKSAPLTA EFYTGWLTHW GESIATTDAS STAKALKSIL    300
CRNGSAVLYM AHGGTNFGFY NGANTGQNES AYKADLTSYD YDAPIKEHGD VHNPKYKALR    360
SVIHECTGTP LHPLPANIER SNYGLVKLQK VASLFDIFDK IGDPLKVSVS EQPLSMEQTG    420
QMFGFLLYSS EYEGKGPYSI LSIPKVHDRA QVFVSCSLDG VRNRRYAGII ERWSKKTLQI    480
PSLSCSSKTS LYILVENMGR VNYGPYIFDL KGILSSVEID GVTVRHWKMY PLSFDALGEL    540
SKFQPIQQIT DARASKVPIH GYLQSKFRDS SFYQNEGPEF YEGHFVIGSE NAIKDTFISF    600
RGWNKGVAFV NNFNIGRFWP AMGPQCALYV PAPILKSGDN VVVIFELHSP NPEHTINLVK    660
DPDFTCGPNQ *                                                         720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_422.0e-562190146+
pfam13364BetaGal_dom4_58.0e-658064467+
COG1874LacA3.0e-3437646655+
PLN03059PLN030591.0e-4139362332+
pfam01301Glyco_hydro_352.0e-14239365328+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAV59405.101866722660putative beta-galactosidase [Oryza sativa Japonica Group]
GenBankACR37865.1016701672unknown [Zea mays]
RefSeqNP_001056172.101866722672Os05g0539400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002327549.10316701637predicted protein [Populus trichocarpa]
RefSeqXP_002441448.1016701608hypothetical protein SORBIDRAFT_09g026870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D03864716598A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_C03864716598A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_B03864716598A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_A03864716598A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thc_D03864716598A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8613022421583990
CB628578263473090
GT7948982354346640
DN226550242492900
CB6706202621844450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny