y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g19510.1
FamilyGT66
Protein PropertiesLength: 794 Molecular Weight: 87670 Isoelectric Point: 9.4151
ChromosomeChromosome/Scaffold: 2 Start: 17192477 End: 17198930
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66277220
  CAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNFRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLVNALNIPLSVETVCVF
  TAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYLKTLNTGSLFYATLNALSYFYMVCSWGGYTFIINL
  IPMHVLLCIVTGRYSSRLYIAYAPLVILGTLLAALVPVVGFNAVLTSEHFASFLVFIILHVVAFVYYIKGLLTPRLFKVAMTLVITVGLAVCFAVVAVLV
  ALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIISCFLPLSDASSFMVLYLVTAVYFSGVMVRLMLVLAPAAC
  ILSGIALSSAFDVLTRSMKFQLSKVFNDGSAVSGDSIAEGSTASNDTKGSSTSTVNTNSAKIENRTEKSEKPSKKNRKKDREVTGSVPVKPKKEKRLSVL
  PLEASVVGTLLLIVLGGFYVVHCVWAAAEAYSAPSIVLTSRSREGLHVFDDFREAYAWLSHNTDVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIA
  TVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDSQATPTMLNCLMYKLCYYRFVETDG
Full Sequence
Protein Sequence     Length: 794     Download
MAEPEPTTAA AAPAPGRLRN AFGGVLCAFT LLLIGVLAFS IRLFSVIKYE SVIHEFDPYF    60
NFRVTQFLSK NGIYEFWNWF DDRTWYPLGR VIGGTVYPGL TLTAGSIWWL VNALNIPLSV    120
ETVCVFTAPI FSANASWATY LLTKEAKGTG AGLMAAAILA MVPSYISRSV AGSYDNEAVA    180
IFALVFTFYL YLKTLNTGSL FYATLNALSY FYMVCSWGGY TFIINLIPMH VLLCIVTGRY    240
SSRLYIAYAP LVILGTLLAA LVPVVGFNAV LTSEHFASFL VFIILHVVAF VYYIKGLLTP    300
RLFKVAMTLV ITVGLAVCFA VVAVLVALVA SSPTKGWSGR SLSLLDPTYA SKYIPIIASV    360
SEHQPPTWPS YFMDINVLAF LVPAGIISCF LPLSDASSFM VLYLVTAVYF SGVMVRLMLV    420
LAPAACILSG IALSSAFDVL TRSMKFQLSK VFNDGSAVSG DSIAEGSTAS NDTKGSSTST    480
VNTNSAKIEN RTEKSEKPSK KNRKKDREVT GSVPVKPKKE KRLSVLPLEA SVVGTLLLIV    540
LGGFYVVHCV WAAAEAYSAP SIVLTSRSRE GLHVFDDFRE AYAWLSHNTD VDDKVASWWD    600
YGYQTTAMAN RTVIVDNNTW NNTHIATVGT AMSSPEKAAW EIFDSLDVKY VLVVFGGLVG    660
YPSDDINKFL WMVRIGGGEF PHIKEPDYLR DGQYRVDSQA TPTMLNCLMY KLCYYRFVET    720
DGKGFDRVRG YEIGKKHFKL THFEEVFTTH HWMVRIYKLK PQKNRIRGKL KKLKSSSKTS    780
STLAAGRKKN PWQ*                                                      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1287COG12878.0e-11571767222+
TIGR04154archaeo_STT35.0e-1131290286+
pfam02516STT31.0e-28544719185+
COG1287COG12873.0e-4426440432+
pfam02516STT32.0e-7825474469+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACL54353.1017931753unknown [Zea mays]
GenBankEEC79544.10217933511119hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.1017931787Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002441399.101779316782hypothetical protein SORBIDRAFT_09g025920 [Sorghum bicolor]
RefSeqXP_002456347.10677931705hypothetical protein SORBIDRAFT_03g034385 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A054878320264A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000025776936123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000025776936123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000025776936123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2143
89111
118140
150172
179201
216238
245267
277294
307329
371393
398415
419441
525547
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675442267680
HO4763975562167650
GT0387033523837290
HO778867851442282e-37
HO778867301191482e-37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)