y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g19997.1
FamilyGT77
Protein PropertiesLength: 712 Molecular Weight: 78965.6 Isoelectric Point: 8.2615
ChromosomeChromosome/Scaffold: 2 Start: 17584667 End: 17587451
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT774516710
  VTNFVVCALDHETYEFSVLQGLPVFRDPSSPKNVSFDDCHFGTPCFQRVTKVKSRVVLEILRLGYNVLLSDVDVYWFDNPVQFLYSLGSATFAAQSDEYN
  ETGPINLPRRLNSGFYYARSDHATITAMEMVVKHANKSSSSEQPSFYDILCGQEGANRHGNNICLEPSTNLTVMFLDRNLFPNGAYRRLWERRDVRSACR
  ELGCFVLHNNWVNGRKKKLRR
Full Sequence
Protein Sequence     Length: 712     Download
MLLPSHAHRR PPLPRRRSVV SHATSPRGAG GIIAILAFVF LTAASLHHAS SRARARERRI    60
ADRRVPRLGG AAAPRVTIFS APLSPADGGS PERQELALRS WLALRGDVSV VLLGPHPPSA    120
ALAVAARLGR RVTVEAAVDC SFTGTPFFHS MVARAQASES DICVLVDADV LLLPETAALL    180
TNLSRIDHDW LIVSMSRNIS GFAYNLSENG NQWVHADGQV LSLTKEILGD KWAADSSDRG    240
LIMAWNNPRN PLLAGVIPSF LYGRGGHSWW LIHEVISSQM RLVFDASSLV LGLYPENLSA    300
KRVAGSGENG RLPDGSWEFD VNRHLAAVYG SYCYRLPGVH HSPMLYEVIK DSEDYKLSKI    360
EELTLSKFVT GKEQNVHTEG QSHWHKKNIC LSDYLRSLSS ETSEGDRVPY SLGALLQSRA    420
DENRSVVLGV AGASYRDMLM SWACRLRHLG VTNFVVCALD HETYEFSVLQ GLPVFRDPSS    480
PKNVSFDDCH FGTPCFQRVT KVKSRVVLEI LRLGYNVLLS DVDVYWFDNP VQFLYSLGSA    540
TFAAQSDEYN ETGPINLPRR LNSGFYYARS DHATITAMEM VVKHANKSSS SEQPSFYDIL    600
CGQEGANRHG NNICLEPSTN LTVMFLDRNL FPNGAYRRLW ERRDVRSACR ELGCFVLHNN    660
WVNGRKKKLR RQMASGLWDY DPGSRMCLHS WGDAGSFRVM GQFDMSGDTD S*            720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-46451672223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAU03099.1069709140765hypothetical protein [Oryza sativa Japonica Group]
DDBJBAH93216.106970964689Os05g0513700 [Oryza sativa Japonica Group]
GenBankEEC79523.1069709203830hypothetical protein OsI_20607 [Oryza sativa Indica Group]
GenBankEEE64343.106970964691hypothetical protein OsJ_19183 [Oryza sativa Japonica Group]
RefSeqXP_002441368.102971120740hypothetical protein SORBIDRAFT_09g025390 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2850
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL3424482534396910
EL3544682814086880
DN2292052622945540
EX1364522344076400
EH6740232214086280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny