y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi2g24670.1
FamilyGH35
Protein PropertiesLength: 735 Molecular Weight: 81114.4 Isoelectric Point: 6.8568
ChromosomeChromosome/Scaffold: 2 Start: 22469375 End: 22478926
Descriptionbeta-galactosidase 16
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35492510
  LVLNGTRRILFSGEMHYTRSTPEMWPKIIAKARKGGIDVIQTYVFWNVHEPVQGKYNFEGRYNIVKFIREIQAQGLYVSLRIGPFIEAEWKYGGFPFWLH
  EVPNITFRTDNEPFKQHMQGFVTHMVNMMKNEGLYYPQGGPIIISQIENEYQMVEPAFGPGGPRYVQWAASLAVGLQTGVPWMMCKQNDAPDPIVKTQGL
  MEL
Full Sequence
Protein Sequence     Length: 735     Download
MAVVTVVALA VLGACAWAAA AVSSAGALFG EEGGEGGVGR EATYDGRALV LNGTRRILFS    60
GEMHYTRSTP EMWPKIIAKA RKGGIDVIQT YVFWNVHEPV QGKYNFEGRY NIVKFIREIQ    120
AQGLYVSLRI GPFIEAEWKY GGFPFWLHEV PNITFRTDNE PFKQHMQGFV THMVNMMKNE    180
GLYYPQGGPI IISQIENEYQ MVEPAFGPGG PRYVQWAASL AVGLQTGVPW MMCKQNDAPD    240
PIVKTQGLME LFCVQLSYIC TMEEQTSGGL PLHMSQQATT MEHLLMSMAH VFETKLKCVA    300
FLVNFDKHQR PTVIFRNISL QLAPKSISIL SDCRTVVFET GKVNAQHGSR TAEVVQSLND    360
THTWKAFKES IPQDISKAAY TGKQLFEHLS TTKDETDYLW YIASYEYRPS DDSHLVLLNV    420
ESQAHILHAF VNGEFVGSVH GSHGARGYII LNMTISLKEG QNTISLLNVM VGSPDSGAHM    480
ERRSFGIHKV SIQQGQHALH LLNNELWGYQ VGLFGEGNRI YTQEGSHSVE WTDVNNLTYL    540
PLTWYQTTFA TPMGNDAVTL NLTSMGKGEV WINGESIGRY WVSFKTPSGQ PSQSLYHIPQ    600
HFLKNTDNLL VLVEEMGGNP LQITVNTVSI TTVCSSVNEL SAPPVQSQGK DPEVRLRCQK    660
GKHISAVEFA SYGNPAGDCR TFTIGSCHAE SSESVVKQAC IGKRSCSIPV GPGSFGGDPC    720
PGIQKSLLVV AHCR*                                                     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA1.0e-1744199166+
pfam02140Gal_Lectin9.0e-2165673382+
pfam01301Glyco_hydro_352.0e-9148243200+
PLN03059PLN030597.0e-9243245203+
PLN03059PLN030591.0e-100289733479+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACC64531.103824525232beta-galactosidase 6 [Oryza sativa Indica Group]
GenBankACC64531.10289734366811beta-galactosidase 6 [Oryza sativa Indica Group]
GenBankEEC79266.103873421761hypothetical protein OsI_20049 [Oryza sativa Indica Group]
GenBankEEE63798.103873425765hypothetical protein OsJ_18622 [Oryza sativa Japonica Group]
Swiss-ProtQ75HQ30289734330775BGAL7_ORYSJ RecName: Full=Beta-galactosidase 7; Short=Lactase 7; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A5e-334961715575A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D2e-244119910166A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.005513652501641A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C2e-244119910166A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C0.005513652501641A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV4754071854206040
DV475407983174140
CJ6587242563295840
CJ5510902474897350
HO1326122205167350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)